KEGG   Pseudomonas monteilii SB3078: X969_19985
Entry
X969_19985        CDS       T02972                                 

Name
(GenBank) aldehyde dehydrogenase
  KO
K19700  3-succinoylsemialdehyde-pyridine dehydrogenase [EC:1.2.1.83]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00760  Nicotinate and nicotinamide metabolism
pmon01100  Metabolic pathways
pmon01120  Microbial metabolism in diverse environments
Module
pmon_M00811  Nicotine degradation, pyrrolidine pathway, nicotine => succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    X969_19985
Enzymes [BR:pmon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.83  3-succinoylsemialdehyde-pyridine dehydrogenase
     X969_19985
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AHC84128
Position
complement(4228755..4230179)
AA seq 474 aa
MRDYRKFYINGEWIMPVGGEELEVINPATESIAGVITLGTADHVDLAVKSARLAFESWSR
TSKEQRLELLEKVCQIFEARMEDIAGAITEEMGAPFKQLARPLQAPSGLGHFLTAISVLR
NYQFEECSGTTRVVREPVGVCGLITPWNWPMNQVAAKVAPALAAGCTVVLKPSEIAPFSA
YLLAEILDEAGLPPGVFNLINGNGSGVGAPLAAHVDVDLISFTGSTTAGALVSKAAADSV
KRVALELGGKSANIILDDADLASAVSHGVMTMMLNTGQSCNAPSRMLVPASKLLEVERIA
KKLCEEIIVGNPLDERTSLGPLASAVQYERVQVCIRNGLAEGAKLVCGGLGVPDGVRAGY
YAKPTVFSNVANDMAIAQEEIFGPVLCIIPYTDAENAIAIANDSCFGLSGYVSSGSLARA
REVANRLRTGSVHLNGAPLDFSAPFGGYKKSGNGREWGKYGFEEYLEIKSIMGC
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgcgtgattatcggaagttttatataaacggcgaatggataatgccagtggggggcgaa
gaactcgaagtgattaaccccgccactgaaagtatagctggtgtaattacactaggaaca
gctgatcatgttgaccttgcggtaaaatcagcgcgccttgcatttgaaagctggtcccgt
acgagcaaagaacaacgacttgagttacttgagaaagtatgtcagatatttgaagccagg
atggaggatatcgctggcgcaattaccgaagagatgggagctccgttcaagcagttagcc
cgccctctccaggcaccatctggcttggggcatttcctaacggcaatctctgtattgcgt
aattaccaatttgaggaatgttcgggaacgactcgtgtagtacgtgagccggtcggagtt
tgcgggttaataacaccttggaactggccaatgaaccaagtggcggcgaaggtcgcacca
gcattagcagctggttgtactgtagtattaaaacccagcgagattgccccattttcagct
tatttacttgcggaaattttggatgaggcgggtcttccgcctggtgtcttcaatcttatt
aatggaaatggttccggtgtgggcgctcctctggctgcacacgtggatgtggatttgatc
tctttcactggttctactactgctggcgcgctcgtctcgaaagcagcagcagattctgtc
aagcgagtagcactagagttgggtggaaaatcggcaaacattatactcgacgacgctgat
ctcgcatctgctgtttcgcatggcgttatgactatgatgctcaataccgggcaaagttgc
aatgctccatcacgcatgctagttccggcatcgaaattgttggaagtagagcggatagca
aagaagctatgtgaagaaataatagtcgggaacccgttagacgaacgcacaagtctcggg
ccgctggcgagcgccgtacagtatgagagagttcaggtctgtatacgaaatggcttagct
gaaggtgcaaagctagtctgtggaggtttaggcgtcccggacggagtaagagctgggtat
tatgctaaaccgacagtttttagcaatgttgcgaacgatatggcgattgcacaggaggaa
atttttggccctgtactttgcattatcccctatacagatgctgaaaatgcgatcgcaata
gcaaatgatagttgttttggtctgtccggatatgttagttcggggagtctggcgcgtgcg
cgcgaggtcgcaaatagactgcgtacaggaagtgtacatcttaacggggcacctctggat
ttttcagcgccgtttggtggttataaaaagtcaggtaacggccgcgaatggggtaaatac
ggctttgaagagtatctcgaaatcaagtcaattatgggctgttaa

DBGET integrated database retrieval system