KEGG   Pseudomonas monteilii SB3078: X969_19995
Entry
X969_19995        CDS       T02972                                 

Name
(GenBank) hypothetical protein
  KO
K20169  nicotine oxidoreductase [EC:1.5.3.-]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00760  Nicotinate and nicotinamide metabolism
pmon01100  Metabolic pathways
pmon01120  Microbial metabolism in diverse environments
Module
pmon_M00811  Nicotine degradation, pyrrolidine pathway, nicotine => succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    X969_19995
Enzymes [BR:pmon01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.-  
     X969_19995
SSDB
Motif
Pfam: Amino_oxidase
Other DBs
NCBI-ProteinID: AHC85810
Position
complement(4232125..4233033)
AA seq 302 aa
MFTERARELDKSSVLDRIKTLGLSRLQQAQINSYMALYAGETTDKFGLPGVLKLFACGGW
NYDAFMDTETHYRIQGGTIGLINAMLTDSGAEVRMSVPVTAVEQVNGGVKIKTDDDEIIT
AGVVVMTVPLNTYKHIGFTPALSKGKQRFIKEGQLSKGAKLYVHVKQNLGRVFAFADEQQ
PLNWVQTHDYSDELGTILSITIARKETIDVNDRDAVTREVQKMFPGVEVLGTAAYDWTAD
PFSLGAWAAYGVGQLSRLKDLQAAEGRILFAGAETSNGWHANIDGAVESGLRAGREVKQL
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgtttactgagcgcgctcgggaattggataaatcttctgttcttgatcgcatcaaaact
ttgggcttaagtcggctgcaacaggctcaaatcaatagttacatggccttgtatgcaggt
gagacaactgacaaatttggcctgcctggtgtacttaagttgtttgcatgcggcggttgg
aactatgacgccttcatggacactgaaactcattatagaattcaagggggcacgataggc
ctcattaatgcaatgttgaccgatagcggtgccgaggtccgcatgtctgtgcccgtcact
gctgttgagcaagtcaatggtggcgtcaaaatcaagaccgacgacgacgaaattattacc
gccggagtggtcgtaatgacagttccactcaatacgtataaacatatcggttttacgcct
gccctttctaaaggtaaacaacgattcatcaaagaggggcagcttagcaaaggtgctaag
ctttatgttcatgttaagcagaatctcggacgggtttttgcgtttgcggatgaacagcaa
cctttaaactgggtccagacgcacgattacagcgacgagttggggacaatactgtcgatc
accatcgctcgcaaagaaacaattgatgtgaatgaccgagatgctgtaactcgcgaagtt
caaaaaatgtttccgggtgttgaggttcttggtacagcggcttacgactggacagctgat
ccattttccttgggggcatgggcggcttatggagtaggtcaactaagtcgtctcaaagat
ctacaggcggctgaaggacgtattttatttgcaggagctgaaaccagtaacggttggcac
gcgaatatcgatggtgctgttgaaagtggactacgtgccggtagggaggttaagcagctc
ttaagctag

DBGET integrated database retrieval system