KEGG   Pseudomonas monteilii SB3101: X970_19630
Entry
X970_19630        CDS       T02973                                 

Name
(GenBank) hypothetical protein
  KO
K20169  nicotine oxidoreductase [EC:1.5.3.-]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00760  Nicotinate and nicotinamide metabolism
pmot01100  Metabolic pathways
pmot01120  Microbial metabolism in diverse environments
Module
pmot_M00811  Nicotine degradation, pyrrolidine pathway, nicotine => succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    X970_19630
Enzymes [BR:pmot01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.-  
     X970_19630
SSDB
Motif
Pfam: Amino_oxidase
Other DBs
NCBI-ProteinID: AHC91170
UniProt: V9VBA1
Position
complement(4180733..4181641)
AA seq 302 aa
MFTERARELDKSSVLDRIKTLGLSRLQQAQINSYMALYAGETTDKFGLPGVLKLFACGGW
NYDAFMDTETHYRIQGGTIGLINAMLTDSGAEVRMSVPVTAVEQVNGGVKIKTDDDEIIT
AGVVVMTVPLNTYKHIGFTPALSKGKQRFIKEGQLSKGAKLYVHVKQNLGRVFAFADEQQ
PLNWVQTHDYSDELGTILSITIARKETIDVNDRDAVTREVQKMFPGVEVLGTAAYDWTAD
PFSLGAWAAYGVGQLSRLKDLQAAEGRILFAGAETSNGWHANIDGAVESGLRAGREVKQL
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgtttactgagcgcgctcgggaattggataaatcttctgttcttgatcgcatcaaaact
ttgggcttaagtcggctgcaacaggctcaaatcaatagttacatggccttgtatgcaggt
gagacaactgacaaatttggcctgcctggtgtacttaagttgtttgcatgcggcggttgg
aactatgacgccttcatggacactgaaactcattatagaattcaagggggcacgataggc
ctcattaatgcaatgttgaccgatagcggtgccgaggtccgcatgtctgtgcccgtcact
gctgttgagcaagtcaatggtggcgtcaaaatcaagaccgacgacgacgaaattattacc
gccggagtggtcgtaatgacagttccactcaatacgtataaacatatcggttttacgcct
gccctttctaaaggtaaacaacgattcatcaaagaggggcagcttagcaaaggtgctaag
ctttatgttcatgttaagcagaatctcggacgggtttttgcgtttgcggatgaacagcaa
cctttaaactgggtccagacgcacgattacagcgacgagttggggacaatactgtcgatc
accatcgctcgcaaagaaacaattgatgtgaatgaccgagatgctgtaactcgcgaagtt
caaaaaatgtttccgggtgttgaggttcttggtacagcggcttacgactggacagctgat
ccattttccttgggggcatgggcggcttatggagtaggtcaactaagtcgtctcaaagat
ctacaggcggctgaaggacgtattttatttgcaggagctgaaaccagtaacggttggcac
gcgaatatcgatggtgctgttgaaagtggactacgtgccggtagggaggttaagcagctc
ttaagctag

DBGET integrated database retrieval system