KEGG   Pseudomonas muyukensis: KSS95_17140
Entry
KSS95_17140       CDS       T07704                                 
Name
(GenBank) DegT/DnrJ/EryC1/StrS family aminotransferase
  KO
K13547  L-glutamine:2-deoxy-scyllo-inosose/3-amino-2,3-dideoxy-scyllo-inosose aminotransferase [EC:2.6.1.100 2.6.1.101]
Organism
pmuy  Pseudomonas muyukensis
Pathway
pmuy00524  Neomycin, kanamycin and gentamicin biosynthesis
pmuy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmuy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KSS95_17140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmuy01007]
    KSS95_17140
Enzymes [BR:pmuy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.100  L-glutamine:2-deoxy-scyllo-inosose aminotransferase
     KSS95_17140
    2.6.1.101  L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase
     KSS95_17140
Amino acid related enzymes [BR:pmuy01007]
 Aminotransferase (transaminase)
  Others
   KSS95_17140
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5
Other DBs
NCBI-ProteinID: QXH33888
Position
complement(3878565..3879839)
AA seq 424 aa
MSGLALFGGTPVHRQAWPQWPQSTLTCERALLTVMRSGRWSVSGLETDASPTWDQRFAEA
FAHYNGVRHCVPTANGTSALMAAMQALGIGAGDEVIVPGLTWVACASAVLAINAVPVIVD
IDPASLCLAPHAVEAAISPRTRAIMVVHLYNAIADLDALLPLARRHGLHLIEDCAQAHGA
QWRGRHVGTLGAVGTFSMQNGKVLTSGEGGACICDDPDLAARIFRLRADGRQRVTDTVPS
GYMTLEEGGQGFAQNACLSEPQAAILLSRLEDLDHENAQRARQAQRLRQLLEEIGGFAFQ
QTAEGTERTTLYHFPVRLEGPEFEGVAIAQVCRALSAELGCWVHPPYPPMDRFAVLAPGH
SQRLLTAPRVPQPLLCAQAAHRQHVMLAHWLFLADDQAMAHVAQAFAKVKEHAHELRARQ
GEGQ
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagcggcctggcattgttcggtggcaccccggtgcatcgccaggcctggccacaatgg
ccgcagtccacgctgacctgcgagcgtgccctgctcacggtgatgcgcagcgggcgttgg
tcggtcagtggcctggagaccgacgccagcccgacctgggaccagcgcttcgccgaagcc
tttgcccattacaacggcgtgcgccattgcgtgcccacggccaacggcaccagtgccctg
atggcggccatgcaggccctgggcatcggcgccggggacgaggtgatcgtcccggggctg
acctgggtggcctgcgccagcgcggtgctggcgatcaacgcggtgccggtcatcgtcgat
atcgaccctgcctcactgtgcctggcgccccatgcggtggaggcggcgatcagcccgcgt
acccgggcgatcatggtggtgcacctgtacaacgccatcgccgacctggatgcgctactg
ccgctggcaaggcgccatggcctgcacctgatcgaggattgtgcccaggcccatggcgcc
cagtggcgagggcggcatgtggggacgctcggcgcggtcggcaccttcagcatgcagaat
ggcaaggtgctgaccagcggcgagggcggtgcctgtatctgcgacgacccagaccttgcc
gcacggatctttcgcctgcgcgcggacggtcggcagcgggtcaccgatacggtgccatcg
ggctacatgaccctggaggagggcggccagggctttgcccagaacgcctgcctcagcgaa
ccccaggcggcgatcctgctcagccgcctggaagaccttgaccatgaaaacgcccagcgc
gcccgccaggcccagcgcttgcgccagctcctcgaggaaatcggcgggttcgccttccag
cagactgccgaaggcaccgaacggaccaccctgtaccactttccggtgcgcctggaaggc
cccgaattcgagggcgtggcgatagcgcaagtgtgccgggcactgtccgccgaactgggc
tgctgggtgcacccgccttatccgccgatggacaggttcgcggtgctcgcccccggccat
tcccagcgcctgttgacggccccgcgggtgccgcaaccgctgctgtgcgcccaggccgcg
catcgccagcacgtaatgctggcccattggttgttcctcgccgacgaccaggccatggcc
catgtcgcgcaggcgttcgccaaggtcaaggagcacgcgcacgaactgcgtgcacgtcaa
ggagaggggcaatga

DBGET integrated database retrieval system