KEGG   Paenibacillus mucilaginosus K02: B2K_30050
Entry
B2K_30050         CDS       T02041                                 
Name
(GenBank) muconate cycloisomerase
  KO
K20022  galactarate dehydratase (D-threo-forming) [EC:4.2.1.158]
Organism
pmw  Paenibacillus mucilaginosus K02
Brite
KEGG Orthology (KO) [BR:pmw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B2K_30050
Enzymes [BR:pmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.158  galactarate dehydratase (D-threo-forming)
     B2K_30050
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N Suv3_N
Other DBs
NCBI-ProteinID: AFH64896
UniProt: I0BR99
Position
complement(7110552..7111721)
AA seq 389 aa
MKITDIRLTVVGMPRHTGFVSKHVIVEIDADNGLTGIGEMSDFSHLPYYSLDIHDLLTVL
KSALLGTNPFDISLSNKVLGSYYPEAMFYYEKGNFIRNGIDTALHDLCAKALGISVSELL
GGRIREKIKVCFPIFRHRFMEEVEENVAVVRRRLAQGFDTFRLYVGKNLDADEAFMDRVR
TEFGSRVTIKSLDFSHLLEWKLALQAAKRFRQYDFQLIESPAVQNDFEGLRHFRLKADHP
VSEHVWSFRQQFEMIRQDSVDIFNISPIFIGGLTSARKAAAAAEVAGKSCLIGTTQELSV
GTASMAHLGSALVNLNYTSDPTGPELYVGDIVKHPVQYQDGYLLVPGRDQPGLGVELDWE
RIGKYRVDDLSWGNISVHQLQDRTAQTKA
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgaaaataacagacatcaggctgacggtagtcggcatgccgcgacataccggattcgtg
agcaagcacgtgatcgtcgaaatcgacgccgataacggattgaccgggatcggggagatg
tccgatttttcccatctgccgtattactcgctcgatattcacgatctgcttaccgtactg
aaatcagccctgctgggaaccaacccgtttgatatttcgctgagcaacaaagtgctgggg
agctattaccctgaggctatgttttattacgagaagggcaattttatccggaacgggatc
gatacggcgcttcatgacctgtgcgccaaggcgctcggcatctcggtttccgagctgctg
ggcggcagaatccgggagaagatcaaggtctgcttcccgatcttccgtcaccgcttcatg
gaagaggtcgaggagaatgtggctgtcgtccgccgccggctggcgcagggcttcgatacg
ttccggctctatgtcggcaaaaatctggatgcggacgaggcgttcatggaccgggtgcgg
acggagttcggcagcagagtcacgatcaagtcgctcgatttcagccatctgctcgaatgg
aagctcgcgctgcaggccgccaagcggttccgccagtacgactttcagctgatcgaaagt
ccggctgtccagaacgacttcgaagggctccgccatttccgtttgaaggcggatcatccg
gtcagcgagcatgtgtggagcttccggcagcagttcgaaatgatccgtcaggactccgtc
gacatcttcaacatttctccgatcttcatcggaggcttgaccagcgcgaggaaggcggcc
gcagccgcggaggtcgcagggaagtcgtgcctgatcggaacgacgcaggagctgtcggtc
ggaacggcttccatggcgcatctcggaagcgcgcttgtcaacctcaactacacgtcggac
ccgaccggaccggaattatatgtcggtgacatcgtgaagcatccggttcaatatcaggac
ggttaccttcttgtgccgggccgcgatcagccgggattgggcgtggaattggactgggag
cggatcgggaagtaccgggtggacgatctgagctgggggaatatttcggtgcaccagctt
caggaccgtacggcccaaacgaaggcgtaa

DBGET integrated database retrieval system