KEGG   Polaromonas naphthalenivorans: Pnap_2478
Entry
Pnap_2478         CDS       T00459                                 

Definition
(GenBank) DSBA oxidoreductase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00626  Naphthalene degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Module
pna_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    Pnap_2478
Enzymes [BR:pna01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     Pnap_2478
SSDB
Motif
Pfam: DSBA
Other DBs
NCBI-ProteinID: ABM37782
UniProt: Q3S4C3
Position
complement(2616304..2616897)
AA seq 197 aa
MMVDFYFDFLSPFSYLANHRLSVLAGRYGFPIQYHAIDLARAKTAIGNIGPSNRDLKTKL
DYLKVDLQRWADLYEIPLVFPPNFNSSRMNAGLYYPAARERAAEYVRFVFDSAWGKGWAL
DADSLLAQVCDKLNWDRGDFETFLCSENAAKAYDEETQAAIDRKVFGVPTVFWDDQMWWG
NDRLFMLESGLQKERQP
NT seq 594 nt   +upstreamnt  +downstreamnt
atgatggttgatttttatttcgattttttgagccccttttcgtacctggcaaaccaccgt
ttgtcggtgctagcggggcgttatggattccccatccagtatcacgccattgatttggcg
cgagcaaagacggccattggcaacatcgggccgtccaatcgggatctgaagacaaaactt
gactatttgaaggtggatttgcagcgatgggccgatctctacgagattccgctggtcttt
ccccccaacttcaacagcagccggatgaacgccgggctgtattacccggctgccagggaa
cgagccgctgaatatgttcgcttcgttttcgattcggcttggggaaaagggtgggcattg
gatgcagatagcttgctggctcaggtatgcgacaagctgaactgggatcgcggtgacttt
gaaacgtttttgtgcagcgaaaatgccgccaaggcatacgacgaggagacgcaggcggcc
attgaccgaaaagtcttcggggttccgaccgtattttgggatgatcaaatgtggtggggg
aatgaccgtcttttcatgcttgagagcgggttgcaaaaggagaggcagccatga

DBGET integrated database retrieval system