KEGG   Polaromonas naphthalenivorans: Pnap_3122
Entry
Pnap_3122         CDS       T00459                                 
Name
(GenBank) LPS biosynthesis protein WbpG
  KO
K24326  aminotransferase
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00541  O-Antigen nucleotide sugar biosynthesis
pna01100  Metabolic pathways
pna01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    Pnap_3122
SSDB
Motif
Pfam: QueC tRNA_Me_trans ATP_bind_3 PAPS_reduct Asn_synthase NAD_synthase ThiI
Other DBs
NCBI-ProteinID: ABM38420
UniProt: A1VRZ2
Position
complement(3313711..3314853)
AA seq 380 aa
MNTQYQLCTRCVMDSSDPAISFNAQGICNHCREFDEVSAKGWFPNEEGARRLAVMVEQIK
AEGKGKPYDCILGLSGGVDSSYLALKVHERGLRPLVVHVDAGWNSELAVANIEKIVKFCD
FDLHTHVVDWEEMRDLQLAFLRSGIANQDVPQDHIFFASIYHYATKHGIKYVLSGGNLAT
EGIYPKAWTGSAMDAINLHAIHRKFGQRRLKDYRTVSFFDYYLWYPFVKQLRTVRPLNYM
PYDKKMAVVELEQKIGWRAYGRKHGESIFTKFFQNYYLPARFGYDKRRPHFSSLIVSGQM
SRDEAMEKLAEPLYSPKELEIDIAYLCKKLGIGRNEFEEFIMAPKHSFLEYPNWISLQNF
IKKMQGLGFRITGRKISIYS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaatacccaatatcagctttgcacccgttgcgtgatggacagcagcgacccggcgatc
agcttcaatgctcagggcatatgcaaccattgccgtgagtttgacgaagtaagcgccaag
gggtggttccccaatgaagaaggcgccaggcgccttgctgtgatggtggagcaaatcaag
gcagagggcaaaggcaaaccttacgattgcattcttggcctgagcggtggcgtggacagt
tcttatctcgcactgaaagtgcatgagcggggcctgcggcccctggtcgtgcatgttgat
gccggctggaacagcgagctggccgttgccaacattgaaaaaatagtgaagttctgcgat
tttgacctgcacacccatgtcgtggattgggaggaaatgcgcgacttgcaactggcattt
cttcgctcgggcattgcaaaccaggatgtgccacaggaccacatttttttcgcgagtatt
tatcactatgcgactaaacatggcatcaagtacgtgctcagcggcggcaatctggccacc
gagggtatttatccaaaggcatggaccgggagtgccatggacgctatcaatcttcatgcc
atccatcgcaagtttggccagcgcaggctaaaggattacaggacggtgagttttttcgat
tactacctctggtatccctttgtgaaacagctgcgcacggttcgtccgctgaactacatg
ccctatgataaaaaaatggctgtagtggaactggagcagaaaatcggctggcgagcgtat
ggacgaaagcacggtgaatccattttcacgaagtttttccagaattattatttgcccgcc
aggttcgggtatgacaaacggcgacctcatttttcgagtttgatagtttcggggcaaatg
tctcgcgacgaggctatggagaaactggccgaacccttgtattctccgaaagagcttgaa
atagatattgcttatctgtgcaagaaactgggaattggccgcaatgagttcgaggaattt
attatggcgcccaagcacagttttctggaatatccgaattggatcagtctccagaatttc
atcaagaaaatgcaggggctgggctttcgtataacaggaagaaaaatcagcatttattcc
tga

DBGET integrated database retrieval system