KEGG   Candidatus Protochlamydia naegleriophila: PNK_0180
Entry
PNK_0180          CDS       T04212                                 
Name
(GenBank) conserved putative membrane protein
Organism
pnl  Candidatus Protochlamydia naegleriophila
SSDB
Motif
Pfam: UPF0242 PAS_12
Other DBs
NCBI-ProteinID: CUI15818
UniProt: A0A0U5JAE2
Position
cPNK:complement(226426..227754)
AA seq 442 aa
MNQVNEIVSSNMKFKTNNRQYLSIAIIFFYLLPLLFFASYSIGLMSHHKSWSMLSFGLLL
IACGSLCLILLIYYWELALKEKLQTEQSKLFHQISFNPEKENKVTSLDTSHTFPQLIDSE
PHSIKDDIKDLSLLETNLKESQSEQMRLEEEVQSKSLAIEHLTEENQLLSVKAQQTSQDF
SDYKLFSEEQLKQKQLQINLLQQMIEDQRGEMEKRQDQIYQLDTKVHDLSYEIKTLLYLH
ETESAPAKKEDTFKTKISGPFLEDLDNYPMHTNFIPSNNHSNSDKWVRSIPEATILLKKC
ITMAQKLTGANYYSNEATRYREFSSSNYAIDQRRLFDGLRNEEGGLIVVYSQKEHKLLFA
NHQSKALLGWSPDKFTSDFSSIIQEGLADWKRGLNTLSSATESQIRLLAKNKNGQEILLS
CHLGIVPSGLFRNYIIGVLYPT
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaatcaagtcaatgaaatcgtatcttccaatatgaaatttaaaacaaataatcggcag
tatctctcgattgccattatttttttctacctcctgcccttgctcttcttcgcatcctat
agtattggactcatgtcgcatcacaaaagttggtcgatgctctcttttggattgttactg
atcgcttgcggatctttatgccttatcctgcttatttattattgggagctcgctttaaaa
gaaaaactccagactgaacagtctaagctctttcatcaaattagctttaatcccgaaaaa
gaaaataaagttacctctctagacacctctcacaccttcccccagctaatcgacagtgag
cctcactccatcaaagatgatattaaagacctgagcctactagagaccaatttaaaagaa
agtcaaagcgaacaaatgcgcttagaagaagaggtgcagagcaaaagcctagccatcgag
catttaaccgaagaaaatcaattgctttctgtcaaagcccagcagacttcccaggatttt
tccgattataaattgttttcagaagagcaactcaaacaaaagcagctgcagattaattta
ctgcagcaaatgatcgaagatcagcgcggcgaaatggaaaaaagacaggatcaaatttat
cagctagatactaaagttcatgatttaagctatgaaattaaaaccctcctttatctgcat
gaaaccgaatctgccccagcaaaaaaggaagatacttttaagacaaagattagcggcccg
tttttagaagacctagataattatcccatgcatacgaactttataccttcgaataatcat
tccaactccgataaatgggttcgaagcattcctgaagccactattcttctaaaaaaatgc
attaccatggctcagaaattaacaggcgccaattactatagcaatgaggcgacaagatac
cgggaattctcttcctctaattatgctatcgaccaaagacgcctctttgacggcctaaga
aacgaagaaggtggtttaatcgttgtctattcgcaaaaagaacataaactcctttttgcc
aatcaccaatccaaggcacttcttggttggagtcccgataagtttacatcagacttctcc
agcatcatccaagaaggattggccgattggaagagaggattaaataccctgtcctccgca
acagaatcgcaaattcgcctactggctaaaaataaaaacggccaagaaatccttttaagc
tgtcacttgggaattgttccttcaggattattcagaaattacattattggcgttctttac
cctacctaa

DBGET integrated database retrieval system