KEGG   Pongo abelii (Sumatran orangutan): 100436782
Entry
100436782         CDS       T01416                                 

Name
(RefSeq) cytochrome P450 3A8 isoform X1
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00140  Steroid hormone biosynthesis
pon00591  Linoleic acid metabolism
pon00830  Retinol metabolism
pon00980  Metabolism of xenobiotics by cytochrome P450
pon00982  Drug metabolism - cytochrome P450
pon00983  Drug metabolism - other enzymes
pon01100  Metabolic pathways
pon04976  Bile secretion
pon05204  Chemical carcinogenesis - DNA adducts
pon05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100436782
   00591 Linoleic acid metabolism
    100436782
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100436782
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100436782
   00982 Drug metabolism - cytochrome P450
    100436782
   00983 Drug metabolism - other enzymes
    100436782
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100436782
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    100436782
   05207 Chemical carcinogenesis - receptor activation
    100436782
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pon00199]
    100436782
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     100436782
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     100436782
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     100436782
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     100436782
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     100436782
    1.14.14.-  
     100436782
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP3 family
   100436782
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100436782
NCBI-ProteinID: XP_002817781
Ensembl: ENSPPYG00000017389
UniProt: H2PLK4 A0A663D9P1
Position
7
AA seq 503 aa
MDLIPDLAMETWILLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPLLGNVFSYRKGFWRF
DMECHKKYGKVWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIARYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIIVFPFLTPILEILNISV
FPREVTSFLRKSVKRMKESRLKDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQRKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHHDPKYWTEPGKFLPERFS
KKNKDNIEPYVYTPFGTGPRNCIGMRFALMNMKLAVIRVLQNFSFKPCKETQIPLKLRLG
GLLQTEKPIVLKVESRDGTLSGA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggatctcatcccagacttggccatggaaacctggattcttctggctgtcagcctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgcctcttttgggaaatgttttttcctaccgtaagggcttttggaggttt
gacatggaatgtcataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgcccggtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaagacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccacaa
gaccccttcgtggaaaacaccaagaagcttttaagatttgatttcttggatccattcttt
ctctcaataatagtctttccattcctcaccccaattcttgaaatattaaatatctctgta
tttccaagagaagttacaagttttttaagaaaatctgtaaaaaggatgaaagaaagtcgc
ctcaaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagaaactgagtcccacaaagctctgtctgatctggagctcgtggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatgtatgaa
ctggccactcaccctgatgtccagcggaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatcttgacatggtggtg
aatgaaacgctcagattattcccaattgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatgttcattcccaaaggggtggtggtgatgattccaagctatgct
cttcaccatgacccaaagtactggacagagcctgggaagttcctccctgaaagattcagc
aagaagaacaaggacaacatagaaccttacgtatacacaccctttggaactggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctgtaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgcttagga
ggacttcttcaaacagaaaaacccattgttctaaaggttgagtcaagggatggcacctta
agtggagcctga

DBGET integrated database retrieval system