KEGG   Komagataella phaffii: PAS_chr2-1_0227
Entry
PAS_chr2-1_0227   CDS       T01092                                 

Name
(RefSeq) hypothetical protein
  KO
K10868  DNA repair protein XRS2
Organism
ppa  Komagataella phaffii
Pathway
ppa03440  Homologous recombination
ppa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PAS_chr2-1_0227
   03450 Non-homologous end-joining
    PAS_chr2-1_0227
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppa03400]
    PAS_chr2-1_0227
DNA repair and recombination proteins [BR:ppa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     PAS_chr2-1_0227
   NHEJ (non-homologous end-joining)
    MRX complex
     PAS_chr2-1_0227
SSDB
Motif
Pfam: BRCT
Other DBs
NCBI-GeneID: 8198776
NCBI-ProteinID: XP_002491117
UniProt: C4R013
Position
2:complement(427947..430154)
AA seq 735 aa
MWILIQDGQEHLLIPGKVYKLGRGSRTSEQSIIDFQCPQPYVSKLQLTISVDQPSSQEIQ
DPKHISRLLIQNVGQGKVHYSGKIYKAKKDPVDIPVDYNQESVTLELGNLTKEYISVRFK
WVNTVLWYSRSDNEDRLDELFHLARSLDIRLVTNYVDNVTLFLQGSQHTSKLAKALIKAI
PIVKFDYLKVLFERKGKLEDSFELPNVENYVPEATLRFNRGRYELFQGLYFLVSRKDSLF
LDFVALAKGKLVVLDLEDPPEILSEKFGLKKLDPQKIICFKPSNEIEREDEHHKMKKLAS
YLGVKLVGNPQVMESILKVDSSMLLTKEPLNLDKKRQISEVSPPETNTTQPKRSRFKRRE
IKPLDAMELLSQQVLSQQHEKKPIESAQRGEEPSVATVKKESRFRRNRMKQIALEDMIDV
SQPNILSTQHDDQEETQIEELNKPLGKATGQTTEVKLTTPIQEDQMVVETELPVKEHSIA
DGSGLVSQHEPKATPEPPSSLVSTTAQVSKAKKPKTYKYTDSQIDALNPNASSNNQQKLS
SMIMQAKELKLKESIDDDIQELLEETTNDTREKLKIHSDETLFRKEKASVRSHVDKSPFH
PEWKGRVNFKKFKRKDLQGSLISTKIYVPLVDCQIEKENEKEKVLTKELEFLNELNQPIQ
DLDSQFPDISGKHKGKRMFVAESDEESEMETEQFESRPRTKTRSSITSRNKPAEPDVIES
DDDDDEPKFRFTTPS
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgtggattttgattcaagatggtcaagagcacttgttgataccgggaaaggtgtataag
ttggggagaggatcacgaacaagtgaacaaagcattatagactttcaatgtccccagccc
tatgtgtcaaaactacaattgacaatttcggttgatcaaccttcatcacaagaaatccaa
gatccaaaacacatttcaagactactaattcaaaatgttggtcagggaaaagttcattat
tctggaaagatctacaaagcgaagaaagatcccgttgacattcctgtggattacaatcaa
gaatcggtcactctagagttgggaaacttgactaaagagtatatctccgtgcggttcaaa
tgggtcaacacggtgctctggtacagtagatccgataatgaggataggcttgacgagttg
tttcatttagcaaggagcttggacatccggttagtgaccaattacgttgataatgttaca
ttgtttctacagggaagtcaacacacgagcaaattggccaaagcactcataaaagcaatt
ccgattgtgaagtttgactatttaaaagtactatttgagcgtaaaggaaagttagaagac
tcatttgaactcccaaatgttgaaaattatgttccagaggcgactcttcggtttaatagg
gggagatacgagttgtttcaagggctgtatttcttggttagcagaaaagattctcttttt
ctggattttgttgccctagcaaaaggaaagcttgttgttcttgatcttgaagatccccca
gaaattctctctgagaagttcggattgaaaaagcttgatccccaaaagataatttgtttc
aagcccagtaatgaaattgaaagagaagatgaacatcataagatgaagaagttggcctca
tatttaggagtcaaacttgtaggaaaccctcaagtcatggaatctattctcaaagtggat
tcatccatgttattgaccaaagaacccctgaatttagataaaaagcgacaaatctctgaa
gtttccccaccggaaactaataccacacaaccaaagagatctaggttcaaaagaagagaa
atcaaaccattggatgcgatggagttattgagccagcaggttttgtctcagcagcatgaa
aagaagccaattgagtcagctcaaagaggagaagaaccatcagtagctaccgttaaaaaa
gaatcaaggtttcgcagaaatcgaatgaaacagattgcattagaagatatgattgatgtc
tcacaaccgaacatactatcgacccagcatgatgaccaggaagagactcaaatcgaagaa
ctgaataaacctttgggtaaagctacaggccagacgacagaggtgaaattgacaacccca
attcaagaggatcaaatggttgtagaaacggaattacccgtgaaggagcacagtatagcc
gatggatcaggtttagtttctcaacacgaacccaaagccacaccagaacctcccagttct
ttagtctccaccacagctcaagtctctaaagctaaaaaacctaaaacatataaatacact
gattctcagatagacgctttgaatccaaatgcatcttccaacaaccaacaaaagcttagt
tcgatgatcatgcaagctaaggagcttaagttgaaggagtctatagatgacgatattcaa
gagcttttggaagagaccactaatgacacaagagaaaaacttaaaattcacagtgacgag
actttatttagaaaagaaaaagcctccgttagatcacatgtcgacaaatcaccattccat
cctgaatggaaggggagagtcaatttcaaaaaattcaaaaggaaagatctacaaggtagc
ctgatatccacaaagatatatgttcctcttgtagactgtcaaatcgagaaggagaatgaa
aaagaaaaggttctgaccaaagagctcgagtttttgaacgaactgaatcaaccaatacag
gatcttgatagccaatttccagatataagtggcaaacataaaggaaagagaatgtttgta
gcggaatcagacgaagaaagtgaaatggagactgagcagtttgagtcaagacctcggacc
aagacaagatcaagtataacttcgagaaataaacctgcagagcctgatgtgatagaatct
gatgatgatgatgacgaacctaaatttcggttcactactccctcatag

DBGET integrated database retrieval system