KEGG   Palaeococcus pacificus: PAP_05980
Entry
PAP_05980         CDS       T03210                                 

Name
(GenBank) sugar kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
ppac  Palaeococcus pacificus
Brite
KEGG Orthology (KO) [BR:ppac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAP_05980
Enzymes [BR:ppac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     PAP_05980
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: AIF69596
UniProt: A0A075LU16
Position
complement(1073258..1074139)
AA seq 293 aa
MFDVVGIGNLNYDIIMLVDRFPEFHEKLPAKNAFFGLGGAAANTISWLARMGLKTGFIGA
VGSDEIGEAHISYFKRIGVDTSRIKVVEGYSGVAVAMIKGEDKRIVKFSGANTSRELDFE
YLAKARHIHLSSNPQKLIINAVNFAYENGISVSLDIGEAKLPESIEEKITYLLMNEDEFK
RKFGSLEHISDVKAKNIIVTLNGGGALIRNEKGDVCRTPRLHAEVVDTTGAGDSFDAGII
YGILKGWSLEKAALLGTLLAYLTVQKVGARSAIVPLEEIKMAAKKLGLELPFE
NT seq 882 nt   +upstreamnt  +downstreamnt
atgtttgatgttgtgggaattggaaacttgaactacgatatcattatgcttgttgataga
tttcctgaattccatgaaaaactccctgcaaaaaacgctttctttggattgggtggtgct
gcagccaatacgatctcatggctcgcacggatgggtttaaagacgggttttattggagct
gttgggagtgatgaaataggagaggcacatataagctacttcaagagaataggggttgac
acgtcgagaataaaagtcgttgaaggctattctggagtagcggtggcaatgataaaagga
gaagataagaggatagtgaagttcagcggtgcgaacacttctagagagctcgactttgag
tatttagcaaaagcaaggcacatccatctctcatcgaatccacaaaagctgatcattaat
gctgttaactttgcttatgagaacggaataagcgtctctcttgacataggtgaggcgaag
cttccagagagcatagaagaaaagataacataccttttgatgaacgaggacgagttcaag
cgcaaatttgggagcttagagcacataagtgatgtaaaggcaaagaacattatagtcaca
ctcaatggtgggggagcattaattaggaacgagaaaggagatgtgtgcagaaccccgagg
cttcatgctgaagtagtggacactacaggagcaggagattcattcgatgctggcataatc
tatggcattctaaaggggtggagccttgagaaagctgctttgttgggaacactgctggct
tatctcacggttcaaaaagtaggtgctcggagtgcgatagtgccactggaagagataaag
atggctgcaaaaaaactagggcttgagcttccctttgaataa

DBGET integrated database retrieval system