KEGG   Paracoccus pantotrophus: ESD82_09910
Entry
ESD82_09910       CDS       T06495                                 

Name
(GenBank) bifunctional 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase
  KO
K20943  resorcinol 4-hydroxylase (NADPH) [EC:1.14.13.219]
Organism
ppan  Paracoccus pantotrophus
Pathway
ppan00362  Benzoate degradation
ppan01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppan00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ESD82_09910
Enzymes [BR:ppan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.219  resorcinol 4-hydroxylase (NADPH)
     ESD82_09910
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox_2 Pyr_redox ApbA DAO FAD_binding_2 NAD_binding_8 HI0933_like NAD_Gly3P_dh_N FAD_oxidored Thi4 3HCDH_N SE
Other DBs
NCBI-ProteinID: QFG36504
Position
pPAN2:420894..422534
AA seq 546 aa
MTPSTQAIDTDVAIVGAGPVGTLLAILLGQRGKRVTLIERWSTHYDLPRAVTFDHEIARI
LATLGIDAESDPSINHHDELYYWRNARGENLQIVDWQSQSASGWRVRYWFNQPLLEKRLL
KIAAGMPEITVMRGWNAVALDQEAEGVTLALQRNPEEVGPDGERRTIRAKFVVGTDGANS
FVRHALGIENEDKGYFFDWLILDMLPKFDYCAAHPDEPAQWQLCDPSRPTTIVPGGPAPL
PGQPDRRRWEFMVLPGESAAEMQTPEKAWELLQPWGLTPENAALERAAVYRFQARWAKQW
HKGRCLIGGDAAHLMPPFAGEGMCAGIRDAVAMAWRLDLILEGKAGLGLLDSYTSERKDH
ACHYIDFSRELGRIICIADAAEAAVRDTRMIAELQARGQRPVPTDICHLGPGAWCPASAH
AGELSVQGVVEHKGRRDRFDQAVGRGWVVIGHEADPLAALTPRQRAQLDLLEGFGVQLCA
PGGGCAVIDTEGTYRRWFDEIDAKFVLIRPDFYVAATANSPEVFQQRVDAVMRTLDLADS
PALAAE
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgaccccatcaacccaagccatcgacaccgatgtcgccatcgtcggcgccggtccggtc
gggacgctgctggcgatcctgctgggccagcgcggcaagcgcgtcacgctgatcgagcgt
tggagcacgcattacgacctgccgcgcgccgtgaccttcgaccacgagatcgcgcgcatc
ctggccacgctgggcatcgacgccgaatccgacccgtcgatcaaccatcacgacgagctt
tactactggcgcaacgccaggggcgagaacctgcagatcgtggattggcagagccagtcg
gccagcggctggcgcgtgcgctactggttcaaccagccgctgctggaaaagcgcctgctg
aagatcgcggccggcatgccggaaatcaccgtgatgcgcggctggaacgccgtcgcgctg
gaccaggaggccgagggcgtcaccctggcgctgcaacggaaccccgaggaggtcggcccg
gatggcgagcgccggacgatccgggcgaaattcgtcgtcggcaccgacggcgccaacagc
ttcgtgcgccatgcgcttggcatcgagaacgaggacaagggctatttcttcgactggctg
atcctcgacatgctgccgaaattcgactattgcgccgcgcacccggatgagccggcgcaa
tggcagctttgcgaccccagccgcccgaccaccatcgtccccggcgggccggcaccgctg
cccggccagcccgaccgccgccgctgggagttcatggtcctgcccggcgaatcggcggcc
gagatgcagaccccggaaaaggcgtgggaattgctgcagccctggggcctgacccccgag
aatgccgcgctggagcgcgccgccgtctatcgcttccaggcccgctgggcgaagcaatgg
cacaagggccgctgcctgatcggcggcgacgccgcgcatctgatgccgccctttgccggc
gagggcatgtgcgccggcatccgcgacgcggtggcgatggcctggcggctggacctgatc
ctcgagggcaaggcagggctcggcctgctcgacagctataccagcgagcgcaaggatcat
gcctgccactacatcgacttcagccgggaactgggccgcatcatctgcatcgccgacgcg
gccgaggccgcggtgcgcgacacccgcatgatcgccgagcttcaggcccgcggccaacgg
ccggtgccgaccgacatctgccatctcggccccggcgcctggtgcccggccagcgcccat
gccggcgagctgtcggtgcagggcgtggtcgagcacaagggccggcgcgaccgcttcgac
caggccgtgggccggggctgggtggtgatcggccacgaggccgatccgctggcggcgctg
acgccgaggcagcgggcgcagcttgacctgctcgaggggttcggcgtgcagctctgcgcc
cccggcggcggctgcgccgtgatcgacaccgagggcacctacaggcgctggttcgacgag
atcgacgcgaaatttgtgctgatccggccggatttctatgttgcggccacagcaaacagc
cccgaggtcttccagcagcgcgtcgatgcggtgatgcgcacgctggacctggccgacagc
ccggcgctggcggcggagtaa

DBGET integrated database retrieval system