Polaribacter pectinis: H9W90_09625 Help Entry H9W90_09625       CDS       T08187                                  Symbol trxA Name (GenBank) thioredoxin   KO K03671   thioredoxin Organism ppec  Polaribacter pectinis Brite KEGG Orthology (KO) [BR:ppec00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ppec03110]     H9W90_09625 (trxA) Chaperones and folding catalysts [BR:ppec03110]  Protein folding catalysts   Protein disulfide isomerase    H9W90_09625 (trxA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 Redoxin AhpC-TSA Thioredoxin_9 Thioredoxin_7 Thioredoxin_3 OST3_OST6 HyaE Glutaredoxin DUF6568 DIM1 TraF Glrx-like GalA_N QSOX_Trx1 Motif Other DBs NCBI-ProteinID:  QNM84456 UniProt:  A0A7G9L757 Position complement(2138197..2138514) Genome browser AA seq 105 aa AA seqDB search MALEITDANFEELVLKSDKPVLVDFWAAWCGPCRMVGPIVDEIHAEYEGKAVVGKVDVDA NQEFAAKYGVRNIPTVLIFKNGEVVDKQVGVAPKNTYTGKIDAAL NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggcattagaaataacagacgcaaattttgaagaattagtattaaaatcagacaagcca gtattggtagatttctgggcagcttggtgtggaccatgtagaatggttggaccaattgta gatgaaattcatgcagaatatgaagggaaagctgtagttggtaaagtagatgtagatgca aaccaagaatttgcagcaaaatacggagtaagaaacataccaactgttttaatctttaaa aacggagaagtagtagataagcaagtaggtgttgctccaaaaaatacatatacaggaaaa attgatgctgctttatag

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (17) Pfam (17) All databases (19) Download RDF

DBGET integrated database retrieval system