KEGG   Pseudomonas putida F1: Pput_2877
Entry
Pput_2877         CDS       T00537                                 
Name
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K16269  cis-1,2-dihydrobenzene-1,2-diol/chlorobenzene dihydrodiol dehydrogenase [EC:1.3.1.19 1.3.1.119]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00361  Chlorocyclohexane and chlorobenzene degradation
ppf00362  Benzoate degradation
ppf00623  Toluene degradation
ppf00624  Polycyclic aromatic hydrocarbon degradation
ppf00643  Styrene degradation
ppf01100  Metabolic pathways
ppf01120  Microbial metabolism in diverse environments
ppf01220  Degradation of aromatic compounds
Module
ppf_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pput_2877
   00361 Chlorocyclohexane and chlorobenzene degradation
    Pput_2877
   00623 Toluene degradation
    Pput_2877
   00643 Styrene degradation
    Pput_2877
   00624 Polycyclic aromatic hydrocarbon degradation
    Pput_2877
Enzymes [BR:ppf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.19  cis-1,2-dihydrobenzene-1,2-diol dehydrogenase
     Pput_2877
    1.3.1.119  chlorobenzene dihydrodiol dehydrogenase
     Pput_2877
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase
Other DBs
NCBI-ProteinID: ABQ79008
UniProt: P13859
Position
complement(3268675..3269502)
AA seq 275 aa
MRLEGEVALVTGGGAGLGRAIVDRYVAEGARVAVLDKSAAGLEALRKLHGDAIVGVEGDV
RSLDSHREAVARCVEAFGKLDCLVGNAGVWDYLTQLVDIPDDLISEAFEEMFEVNVKGYI
LAAKAALPALYQSKGSAIFTVSNAGFYPGGGGVLYTAGKHAVIGLIKQLAHEWGPRIRVN
GIAPGGILGSDLRGLKSLDLQDKSISTFPLDDMLKSVLPTGRAATAEEYAGAYVFFATRG
DTVPLTGSVLNFDGGMGVRGLFEASLGAQLDKHFG
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgagacttgaaggcgaagtggccttggtgacaggcggtggcgcaggcctgggcagagcg
atcgtggatcgttatgtcgcggaaggtgcgcgtgtcgcggtgctggataaatccgcggca
ggcctggaagcgctcaggaaactccatggcgatgcaatcgtgggcgtggagggggatgtt
cgctcgctcgacagccatcgtgaggctgtggcccgctgcgtcgaagcgttcggcaagctg
gactgcctggttggcaatgctggcgtttgggactacctgacccaactggtggatattccc
gacgacctcatatcggaggcattcgaggaaatgttcgaggtcaatgtcaagggctacatc
ctggcggcaaaggctgcgctacctgcgctttatcagagcaaaggcagcgcgatattcact
gtgtcgaatgccggtttctacccgggcggtggcggtgttctgtatacagctggcaaacat
gccgtgattggattgatcaagcagctcgcgcacgaatgggggccgcgtatccgcgtcaac
ggcatcgcccccggtggcattttggggagcgatctgcgcgggctgaagagccttgattta
caagacaagagcatttcgacctttccattggacgacatgctgaaatccgttcttccgacc
gggcgggccgccactgccgaggaatacgccggcgcctatgtcttcttcgcgacgcgcggc
gacacggttccgctcaccggtagcgtgttgaacttcgatggcggcatgggcgtgcgtggc
ttgttcgaagccagcctaggcgcacagctcgacaagcacttcggttga

DBGET integrated database retrieval system