KEGG   Pseudomonas putida F1: Pput_2881
Entry
Pput_2881         CDS       T00537                                 

Name
(GenBank) ring hydroxylating dioxygenase, alpha subunit
  KO
K03268  benzene/toluene/chlorobenzene dioxygenase subunit alpha [EC:1.14.12.3 1.14.12.11 1.14.12.26]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00361  Chlorocyclohexane and chlorobenzene degradation
ppf00362  Benzoate degradation
ppf00623  Toluene degradation
ppf00625  Chloroalkane and chloroalkene degradation
ppf01100  Metabolic pathways
ppf01120  Microbial metabolism in diverse environments
ppf01220  Degradation of aromatic compounds
Module
ppf_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pput_2881
   00625 Chloroalkane and chloroalkene degradation
    Pput_2881
   00361 Chlorocyclohexane and chlorobenzene degradation
    Pput_2881
   00623 Toluene degradation
    Pput_2881
Enzymes [BR:ppf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.3  benzene 1,2-dioxygenase
     Pput_2881
    1.14.12.11  toluene dioxygenase
     Pput_2881
    1.14.12.26  chlorobenzene dioxygenase
     Pput_2881
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABQ79012
UniProt: A5W4F2
Structure
PDB: 
3EQQ 3EN1

Position
complement(3271737..3273089)
AA seq 450 aa
MNQTDTSPIRLRRSWNTSEIEALFDEHAGRIDPRIYTDEDLYQLELERVFARSWLLLGHE
TQIRKPGDYITTYMGEDPVVVVRQKDASIAVFLNQCRHRGMRICRADAGNAKAFTCSYHG
WAYDTAGNLVNVPYEAESFACLNKKEWSPLKARVETYKGLIFANWDENAVDLDTYLGEAK
FYMDHMLDRTEAGTEAIPGVQKWVIPCNWKFAAEQFCSDMYHAGTTSHLSGILAGLPEDL
EMADLAPPTVGKQYRASWGGHGSGFYVGDPNLMLAIMGPKVTSYWTEGPASEKAAERLGS
VERGSKLMVEHMTVFPTCSFLPGINTVRTWHPRGPNEVEVWAFTVVDADAPDDIKEEFRR
QTLRTFSAGGVFEQDDGENWVEIQHILRGHKARSRPFNAEMSMDQTVDNDPVYPGRISNN
VYSEEAARGLYAHWLRMMTSPDWDALKATR
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgaatcagaccgacacatcacctatcaggctgcgcaggagctggaacaccagcgagata
gaagcgctctttgacgagcatgccggacgtatcgatccgcgcatttataccgatgaggat
ctgtaccaactcgaactggagcgtgtcttcgcccggtcctggctgctgttggggcatgaa
acccagattcgcaagccgggcgattacatcacgacctacatgggtgaagaccctgtcgtg
gtcgtccggcagaaagacgccagcattgccgtgttcctgaaccagtgccgccaccgtggc
atgcgcatctgccgcgcggatgccggaaacgcgaaggcgttcacttgcagctaccacggg
tgggcttacgacaccgccggcaatcttgtcaatgtgccttacgaggccgaatccttcgcg
tgcctgaacaagaaggaatggagcccgctgaaggcccgggtagaaacctacaagggcctg
attttcgccaactgggatgagaacgctgtagacctcgacacgtatctgggcgaggcgaag
ttctacatggaccacatgctcgaccgcaccgaggccggcaccgaagcgatcccgggcgtg
cagaagtgggtcattccctgtaactggaaattcgccgcagagcagttttgcagcgacatg
taccatgccgggacgacctcgcatctgtctggcatcctggcaggcctgccagaagacctt
gaaatggccgaccttgctccgccgacagttggcaagcagtaccgtgcgtcatggggcgga
catggaagtggcttctatgtcggcgaccccaatctgatgcttgccatcatggggccaaag
gtcaccagctactggaccgaaggccccgcgtcggaaaaggcggccgaacgtctgggtagc
gtggagcgcggctcgaaactcatggtcgagcacatgaccgtcttccccacgtgttccttc
ctcccaggtatcaatacggtccggacatggcatccgcgcgggccgaacgaggtcgaggta
tgggcgtttacggtggtcgatgctgatgctcctgacgatatcaaggaagagttccggcgc
cagacgctgcgcaccttctctgccggtggcgtgttcgagcaggacgacggggagaactgg
gtcgagatccagcacatcctgcgaggccacaaggcgcggagccgccctttcaatgccgag
atgagcatggaccagaccgtcgacaacgacccggtttaccccgggcggatcagcaacaac
gtctacagcgaggaagctgcccgcgggctctatgcccattggctgcggatgatgacatcc
cccgactgggacgcgctgaaggcgacacgctga

DBGET integrated database retrieval system