KEGG   Pseudomonas putida ND6: ND062
Entry
ND062             CDS       T02170                                 

Gene name
nahD
Definition
(GenBank) 2-hydroxychromene-2-carboxylate dehydrogenase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00626  Naphthalene degradation
ppi01100  Metabolic pathways
ppi01120  Microbial metabolism in diverse environments
ppi01220  Degradation of aromatic compounds
Module
ppi_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    ND062 (nahD)
Enzymes [BR:ppi01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     ND062 (nahD)
SSDB
Motif
Pfam: DSBA Thioredoxin_5 DUF1479
Other DBs
NCBI-ProteinID: AAP44193
UniProt: Q6XUU2
Position
pND6-1:63246..63884
AA seq 212 aa
MLLCRLLFLECLIVIVDFYFDFLSPFSYLANHRLSKLAQDYGFSIRYYAIDLARVKIAIG
NVGPSNRDLIVKLDYLKVDLQRWAELYEIPLVFPANYNSRRMNTGLYYSGAMAQTGAYVN
VVFNAVWGDGIAPDLESLPALVSEKLGWDRSAFEDFISSDAATERYDEQTHAAIERKVFG
VPTMFLGDEMWWGNDRLFMLENAVGGAPVNGE
NT seq 639 nt   +upstreamnt  +downstreamnt
ttgctattgtgccgacttctgttcttggagtgtttgattgtgattgtcgatttttatttc
gattttttgagtccgttctcttacttggccaaccatcgtttgtcaaagcttgcgcaagac
tatggcttttccattcgttattacgcaatcgatttggcgcgagttaaaatagccatcgga
aacgttggtccatctaatcgcgacctgatagtcaagctggactatttgaaagtagatttg
caacggtgggccgagctttacgaaataccgttggtattcccagctaactacaacagccga
cggatgaatactgggctttattactcgggagccatggcacagactggtgcctatgtgaat
gtagtatttaatgcggtttggggagatggcatagctccagatttggaaagcttgcctgct
ctggtatctgaaaaactaggctgggatcgtagcgccttcgaggactttatcagcagcgat
gccgcaacagagaggtatgacgagcagacacatgccgcgatcgaacgcaaagtgttcggt
gtgccaacgatgtttttgggcgatgaaatgtggtggggaaacgaccgtctatttatgctc
gagaacgcagtgggaggtgcgcctgtaaatggagaatag

DBGET integrated database retrieval system