KEGG   Pseudomonas plecoglossicida: RK21_02869
Entry
RK21_02869        CDS       T03646                                 

Name
(GenBank) alcohol dehydrogenase
  KO
K19961  6-hydroxyhexanoate dehydrogenase [EC:1.1.1.258]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00930  Caprolactam degradation
ppj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RK21_02869
Enzymes [BR:ppj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.258  6-hydroxyhexanoate dehydrogenase
     RK21_02869
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ThiF PglD_N TrkA_N Sacchrp_dh_NADP AlaDh_PNT_C zf-CXXC 2-Hacid_dh_C FAD_binding_3 Glu_dehyd_C Pyr_redox
Other DBs
NCBI-ProteinID: AJG14377
UniProt: A0A0B5KJQ9
Position
3013567..3014538
AA seq 323 aa
MLLRVKAAGLCHTDLHLWEGFYDLGAGKRLMLADRGIKPPMVLSHEVCGEVISAGSEAGD
VKIGMRSLVHPWIGCGECAACQRGEENICIKPQALGVMRAGGFAEYVVVPHPRYLVDIEG
LDDAEAAPLACAGVTTFSAIYKFGNRIHEGPVVIIGAGGLGLMAIEVLKAMGAKGAVVVD
IDASKREAALAAGALAAIDGKAADAAQQIMQATDGGARAVLDLVGATATVTLAIASCARG
GHIVICGLMGGDITLSLPVIPMRPLTIEGSYVGSLAELRELVKLVKRTGMSAIPVTRRPM
SEINAAMQDLHNGKVIGRTVLIP
NT seq 972 nt   +upstreamnt  +downstreamnt
gtgctgctgcgagtgaaagctgccggtttgtgtcacaccgaccttcatctctgggaaggc
ttttacgacctgggtgctggcaagcgtctgatgttggccgatcgcggaatcaaaccgccg
atggtcctcagccacgaagtatgcggtgaagtcatctctgctggcagcgaggcgggagac
gtaaagattggtatgcgcagtcttgtacacccgtggattggttgtggtgaatgcgcagcc
tgccagcgcggcgaagaaaatatctgcatcaaaccgcaggcgttaggcgtgatgcgggcg
ggagggtttgccgagtatgtcgtcgtgccgcatccgcgctacttagtggatatcgaggga
cttgacgacgcagaggcggcaccgctggcttgcgctggtgttacgacttttagtgctatc
tacaagtttggtaaccgtattcatgaaggcccggtggtcatcatcggtgccggcggtctg
ggcctgatggctattgaggtactcaaggcaatgggtgccaaaggcgctgtcgtggtcgat
atcgacgcgagtaagcgcgaggcagcgctcgcggctggtgcgttagcggccatcgacggc
aaggccgctgatgccgcacaacagatcatgcaagccaccgatggtggtgcacgtgcagtg
cttgacttggtgggcgctacggcgacggtgaccctggccatcgcgagctgtgcgcgtggt
gggcacatcgtcatctgcgggctgatggggggcgatatcaccctgtcgctgccagtgatc
ccgatgcgcccgctgaccattgaaggcagctatgtcggctcactggccgagttgcgcgag
ttggtgaagttggtcaagcgtacaggaatgtctgcaattcccgtgacgcgccgtcctatg
tccgaaatcaacgccgccatgcaagacctgcataacggcaaggtgatcggccgtacggtc
cttattccctga

DBGET integrated database retrieval system