KEGG   Pan paniscus (bonobo): 100967981
Entry
100967981         CDS       T02283                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04066  HIF-1 signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04310  Wnt signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04510  Focal adhesion
pps04540  Gap junction
pps04613  Neutrophil extracellular trap formation
pps04650  Natural killer cell mediated cytotoxicity
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04670  Leukocyte transendothelial migration
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04727  GABAergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps04960  Aldosterone-regulated sodium reabsorption
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
pps05031  Amphetamine addiction
pps05032  Morphine addiction
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05214  Glioma
pps05223  Non-small cell lung cancer
pps05225  Hepatocellular carcinoma
pps05231  Choline metabolism in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100967981 (PRKCA)
   04012 ErbB signaling pathway
    100967981 (PRKCA)
   04014 Ras signaling pathway
    100967981 (PRKCA)
   04015 Rap1 signaling pathway
    100967981 (PRKCA)
   04310 Wnt signaling pathway
    100967981 (PRKCA)
   04370 VEGF signaling pathway
    100967981 (PRKCA)
   04066 HIF-1 signaling pathway
    100967981 (PRKCA)
   04020 Calcium signaling pathway
    100967981 (PRKCA)
   04070 Phosphatidylinositol signaling system
    100967981 (PRKCA)
   04072 Phospholipase D signaling pathway
    100967981 (PRKCA)
   04071 Sphingolipid signaling pathway
    100967981 (PRKCA)
   04151 PI3K-Akt signaling pathway
    100967981 (PRKCA)
   04150 mTOR signaling pathway
    100967981 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100967981 (PRKCA)
   04540 Gap junction
    100967981 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100967981 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    100967981 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    100967981 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    100967981 (PRKCA)
   04670 Leukocyte transendothelial migration
    100967981 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    100967981 (PRKCA)
   04929 GnRH secretion
    100967981 (PRKCA)
   04912 GnRH signaling pathway
    100967981 (PRKCA)
   04921 Oxytocin signaling pathway
    100967981 (PRKCA)
   04926 Relaxin signaling pathway
    100967981 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    100967981 (PRKCA)
   04918 Thyroid hormone synthesis
    100967981 (PRKCA)
   04919 Thyroid hormone signaling pathway
    100967981 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    100967981 (PRKCA)
   04916 Melanogenesis
    100967981 (PRKCA)
   04925 Aldosterone synthesis and secretion
    100967981 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100967981 (PRKCA)
   04270 Vascular smooth muscle contraction
    100967981 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    100967981 (PRKCA)
   04971 Gastric acid secretion
    100967981 (PRKCA)
   04972 Pancreatic secretion
    100967981 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100967981 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100967981 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100967981 (PRKCA)
   04727 GABAergic synapse
    100967981 (PRKCA)
   04725 Cholinergic synapse
    100967981 (PRKCA)
   04728 Dopaminergic synapse
    100967981 (PRKCA)
   04726 Serotonergic synapse
    100967981 (PRKCA)
   04720 Long-term potentiation
    100967981 (PRKCA)
   04730 Long-term depression
    100967981 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    100967981 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100967981 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    100967981 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100967981 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100967981 (PRKCA)
   05206 MicroRNAs in cancer
    100967981 (PRKCA)
   05205 Proteoglycans in cancer
    100967981 (PRKCA)
   05231 Choline metabolism in cancer
    100967981 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100967981 (PRKCA)
   05214 Glioma
    100967981 (PRKCA)
   05223 Non-small cell lung cancer
    100967981 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100967981 (PRKCA)
   05161 Hepatitis B
    100967981 (PRKCA)
   05171 Coronavirus disease - COVID-19
    100967981 (PRKCA)
   05164 Influenza A
    100967981 (PRKCA)
   05163 Human cytomegalovirus infection
    100967981 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100967981 (PRKCA)
   05143 African trypanosomiasis
    100967981 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100967981 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    100967981 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100967981 (PRKCA)
   05032 Morphine addiction
    100967981 (PRKCA)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100967981 (PRKCA)
   05415 Diabetic cardiomyopathy
    100967981 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100967981 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100967981 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100967981 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100967981 (PRKCA)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100967981 (PRKCA)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100967981 (PRKCA)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100967981 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C ABC1 APH Kinase-like
Other DBs
NCBI-GeneID: 100967981
NCBI-ProteinID: XP_003812415
Position
17
AA seq 543 aa
MKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPN
GLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDR
TTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAK
LGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKI
LKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHI
QQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHM
MVGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQS
IMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENRE
IQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQ
SAV
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgaaatgtgacacctgcgatatgaacgttcacaagcaatgcgtcatcaatgtccccagc
ctctgcggaatggatcacactgagaagagggggcggatttacctaaaggctgaggttgct
gatgaaaagctccatgtcacagtacgagatgcaaaaaatctaatccctatggatccaaac
gggctttcagatccttatgtgaagctgaaacttattcctgatcccaagaatgaaagcaag
caaaaaaccaaaaccatccgctccacactaaatccgcagtggaatgagtcctttacattc
aaattgaaaccttcagacaaagaccgacgactgtctgtagaaatctgggactgggatcga
acaacaaggaatgacttcatgggatccctttcctttggagtttcggagctgatgaagatg
ccggccagtggatggtacaagttgcttaaccaagaagaaggtgagtactacaatgtaccc
attccggaaggggacgaagaaggaaacatggaactcaggcagaaattcgagaaagccaaa
cttggccctgctggcaacaaagtcatcagtccctctgaagacaggaaacaaccttccaac
aaccttgaccgagtgaaactcacggacttcaatttcctcatggtgttgggaaaggggagt
tttggaaaggtgatgcttgccgacaggaagggcacagaagaactgtatgcaatcaaaatc
ctgaagaaggatgtggtgattcaggatgatgacgtggagtgcaccatggtagaaaagcga
gtcttggccctgcttgacaaacccccgttcttgacgcagctgcactcctgcttccagaca
gtggatcggctgtacttcgtcatggaatatgtcaacggtggggacctcatgtaccacatt
cagcaagtaggaaaatttaaggaaccacaagcagtattctatgcagcagagatttccatc
ggattgttctttcttcataaaagaggaatcatttacagggatctgaagttagataacgtc
atgttggattcagaaggacatatcaaaattgctgactttgggatgtgcaaggaacacatg
atggttggagtcacgaccaggaccttctgtgggactccagattatatcgccccagagata
atcgcttatcagccgtatggaaaatctgtggactggtgggcctatggcgtcctgttgtat
gaaatgcttgccgggcagcctccatttgatggtgaagatgaagacgagctatttcagtct
atcatggagcacaacgtttcctatccaaaatccttgtccaaggaggctgtttctatctgc
aaaggactgatgaccaaacacccagccaagcggctgggctgtgggcctgagggggagagg
gacgtgagagaacatgccttcttccggaggatcgactgggaaaaactggagaacagggag
atccagccaccattcaagcccaaagtgtgcggcaaaggagcagagaactttgacaagttc
ttcacacgaggacagcccgtcttaacaccgcctgatcagctggttattgctaatatagac
cagtctgattttgaagggttctcgtatgtcaacccccagtttgtgcaccccatcttacag
agtgcagtatga

KEGG   Pan paniscus (bonobo): 100970296
Entry
100970296         CDS       T02283                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04062  Chemokine signaling pathway
pps04064  NF-kappa B signaling pathway
pps04066  HIF-1 signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04071  Sphingolipid signaling pathway
pps04150  mTOR signaling pathway
pps04270  Vascular smooth muscle contraction
pps04310  Wnt signaling pathway
pps04370  VEGF signaling pathway
pps04510  Focal adhesion
pps04540  Gap junction
pps04613  Neutrophil extracellular trap formation
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04670  Leukocyte transendothelial migration
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04727  GABAergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04925  Aldosterone synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04931  Insulin resistance
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps04960  Aldosterone-regulated sodium reabsorption
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04973  Carbohydrate digestion and absorption
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
pps05031  Amphetamine addiction
pps05032  Morphine addiction
pps05140  Leishmaniasis
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05214  Glioma
pps05223  Non-small cell lung cancer
pps05225  Hepatocellular carcinoma
pps05231  Choline metabolism in cancer
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100970296 (PRKCB)
   04012 ErbB signaling pathway
    100970296 (PRKCB)
   04014 Ras signaling pathway
    100970296 (PRKCB)
   04015 Rap1 signaling pathway
    100970296 (PRKCB)
   04310 Wnt signaling pathway
    100970296 (PRKCB)
   04370 VEGF signaling pathway
    100970296 (PRKCB)
   04064 NF-kappa B signaling pathway
    100970296 (PRKCB)
   04066 HIF-1 signaling pathway
    100970296 (PRKCB)
   04020 Calcium signaling pathway
    100970296 (PRKCB)
   04070 Phosphatidylinositol signaling system
    100970296 (PRKCB)
   04071 Sphingolipid signaling pathway
    100970296 (PRKCB)
   04150 mTOR signaling pathway
    100970296 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100970296 (PRKCB)
   04540 Gap junction
    100970296 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100970296 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    100970296 (PRKCB)
   04662 B cell receptor signaling pathway
    100970296 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    100970296 (PRKCB)
   04670 Leukocyte transendothelial migration
    100970296 (PRKCB)
   04062 Chemokine signaling pathway
    100970296 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    100970296 (PRKCB)
   04929 GnRH secretion
    100970296 (PRKCB)
   04912 GnRH signaling pathway
    100970296 (PRKCB)
   04921 Oxytocin signaling pathway
    100970296 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    100970296 (PRKCB)
   04918 Thyroid hormone synthesis
    100970296 (PRKCB)
   04919 Thyroid hormone signaling pathway
    100970296 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    100970296 (PRKCB)
   04916 Melanogenesis
    100970296 (PRKCB)
   04925 Aldosterone synthesis and secretion
    100970296 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100970296 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    100970296 (PRKCB)
   04971 Gastric acid secretion
    100970296 (PRKCB)
   04972 Pancreatic secretion
    100970296 (PRKCB)
   04973 Carbohydrate digestion and absorption
    100970296 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100970296 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100970296 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100970296 (PRKCB)
   04727 GABAergic synapse
    100970296 (PRKCB)
   04725 Cholinergic synapse
    100970296 (PRKCB)
   04728 Dopaminergic synapse
    100970296 (PRKCB)
   04726 Serotonergic synapse
    100970296 (PRKCB)
   04720 Long-term potentiation
    100970296 (PRKCB)
   04730 Long-term depression
    100970296 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    100970296 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100970296 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100970296 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100970296 (PRKCB)
   05206 MicroRNAs in cancer
    100970296 (PRKCB)
   05205 Proteoglycans in cancer
    100970296 (PRKCB)
   05231 Choline metabolism in cancer
    100970296 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100970296 (PRKCB)
   05214 Glioma
    100970296 (PRKCB)
   05223 Non-small cell lung cancer
    100970296 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100970296 (PRKCB)
   05161 Hepatitis B
    100970296 (PRKCB)
   05171 Coronavirus disease - COVID-19
    100970296 (PRKCB)
   05164 Influenza A
    100970296 (PRKCB)
   05163 Human cytomegalovirus infection
    100970296 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100970296 (PRKCB)
   05140 Leishmaniasis
    100970296 (PRKCB)
   05143 African trypanosomiasis
    100970296 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100970296 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    100970296 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100970296 (PRKCB)
   05032 Morphine addiction
    100970296 (PRKCB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100970296 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100970296 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100970296 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100970296 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100970296 (PRKCB)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100970296 (PRKCB)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100970296 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 Pkinase_C C1_1 Kinase-like CEP76-C2 ABC1 APH
Other DBs
NCBI-GeneID: 100970296
NCBI-ProteinID: XP_003813767
Position
16
AA seq 542 aa
MKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPN
GLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDL
TSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAK
ISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYA
VKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLM
YHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCK
ENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDEL
FQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLE
RKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVI
NV
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgaaatgtgacacctgcatgatgaatgtgcacaagcgctgcgtgatgaatgttcccagc
ctgtgtggcacggaccacacggagcgccgcggccgcatctacatccaggcccacatcgac
agggacgtcctcattgtcctcgtaagagatgctaaaaaccttgtacctatggaccccaat
ggcctgtcagatccctacgtaaaactgaaactgattcccgatcccaaaagtgagagcaaa
cagaagaccaaaaccatcaaatgctccctcaaccctgagtggaatgagacatttagattt
cagctgaaagaatcggacaaagacagaagactgtcagtagagatttgggattgggatttg
accagcaggaatgacttcatgggatctttgtcctttgggatttctgaacttcagaaagcc
agtgttgatggctggtttaagttactgagccaggaggaaggcgagtacttcaatgtgcct
gtgccaccggaaggaagtgaggccaatgaagaactgcggcagaaatttgagagggccaag
atcagtcagggaaccaaggtcccggaagaaaagacgaccaacactgtctccaaatttgac
aacaatggcaacagagaccggatgaaactgaccgattttaacttcctaatggtgctgggg
aaaggcagctttggcaaggtcatgctttcagaacgaaaaggcacagatgagctctatgct
gtgaagatcctgaagaaggacgttgtgatccaagatgatgacgtggagtgcactatggtg
gagaagcgggtgttggccctgcccgggaagccgcccttcctgacccagctccactcctgc
ttccagaccatggaccgcctgtactttgtgatggagtacgtgaatgggggcgacctcatg
tatcacatccagcaagtcggccggttcaaggagccccatgctgtattttacgctgcagaa
attgccatcggtctgttcttcttacagagtaagggcatcatttaccgtgacctaaaactt
gacaacgtgatgctcgattctgagggacacatcaagattgccgattttggcatgtgtaag
gaaaacatctgggatggggtgacaaccaagacattctgtggcactccagactacatcgcc
cccgagataattgcttatcagccctatgggaagtccgtggattggtgggcatttggagtc
ctgctgtatgaaatgttggctgggcaggcaccctttgaaggggaagatgaagatgaactc
ttccaatccatcatggaacacaacgtagcctatcccaagtctatgtccaaggaagctgtg
gccatctgcaaagggctgatgaccaaacacccgggcaaacgtctgggttgtggacctgaa
ggcgaacgtgatatcaaagagcatgcatttttccggtatattgattgggagaaacttgaa
cgcaaagagatccagcccccatataagccaaaagctagagacaagagagacacctccaac
ttcgacaaagagttcaccagacagcctgtggaactgacccccactgataaactcttcatc
atgaacttggaccaaaatgaatttgctggcttctcttatactaacccagagtttgtcatt
aatgtgtag

KEGG   Pan paniscus (bonobo): 100990245
Entry
100990245         CDS       T02283                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04066  HIF-1 signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04071  Sphingolipid signaling pathway
pps04150  mTOR signaling pathway
pps04270  Vascular smooth muscle contraction
pps04310  Wnt signaling pathway
pps04370  VEGF signaling pathway
pps04510  Focal adhesion
pps04540  Gap junction
pps04613  Neutrophil extracellular trap formation
pps04650  Natural killer cell mediated cytotoxicity
pps04666  Fc gamma R-mediated phagocytosis
pps04670  Leukocyte transendothelial migration
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04727  GABAergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04925  Aldosterone synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04935  Growth hormone synthesis, secretion and action
pps04960  Aldosterone-regulated sodium reabsorption
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
pps05031  Amphetamine addiction
pps05032  Morphine addiction
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05214  Glioma
pps05223  Non-small cell lung cancer
pps05225  Hepatocellular carcinoma
pps05231  Choline metabolism in cancer
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100990245 (PRKCG)
   04012 ErbB signaling pathway
    100990245 (PRKCG)
   04014 Ras signaling pathway
    100990245 (PRKCG)
   04015 Rap1 signaling pathway
    100990245 (PRKCG)
   04310 Wnt signaling pathway
    100990245 (PRKCG)
   04370 VEGF signaling pathway
    100990245 (PRKCG)
   04066 HIF-1 signaling pathway
    100990245 (PRKCG)
   04020 Calcium signaling pathway
    100990245 (PRKCG)
   04070 Phosphatidylinositol signaling system
    100990245 (PRKCG)
   04071 Sphingolipid signaling pathway
    100990245 (PRKCG)
   04150 mTOR signaling pathway
    100990245 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100990245 (PRKCG)
   04540 Gap junction
    100990245 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100990245 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    100990245 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    100990245 (PRKCG)
   04670 Leukocyte transendothelial migration
    100990245 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    100990245 (PRKCG)
   04929 GnRH secretion
    100990245 (PRKCG)
   04921 Oxytocin signaling pathway
    100990245 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    100990245 (PRKCG)
   04918 Thyroid hormone synthesis
    100990245 (PRKCG)
   04919 Thyroid hormone signaling pathway
    100990245 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    100990245 (PRKCG)
   04916 Melanogenesis
    100990245 (PRKCG)
   04925 Aldosterone synthesis and secretion
    100990245 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100990245 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    100990245 (PRKCG)
   04971 Gastric acid secretion
    100990245 (PRKCG)
   04972 Pancreatic secretion
    100990245 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100990245 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100990245 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    100990245 (PRKCG)
   04727 GABAergic synapse
    100990245 (PRKCG)
   04725 Cholinergic synapse
    100990245 (PRKCG)
   04728 Dopaminergic synapse
    100990245 (PRKCG)
   04726 Serotonergic synapse
    100990245 (PRKCG)
   04720 Long-term potentiation
    100990245 (PRKCG)
   04730 Long-term depression
    100990245 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    100990245 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100990245 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100990245 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100990245 (PRKCG)
   05206 MicroRNAs in cancer
    100990245 (PRKCG)
   05205 Proteoglycans in cancer
    100990245 (PRKCG)
   05231 Choline metabolism in cancer
    100990245 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100990245 (PRKCG)
   05214 Glioma
    100990245 (PRKCG)
   05223 Non-small cell lung cancer
    100990245 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100990245 (PRKCG)
   05161 Hepatitis B
    100990245 (PRKCG)
   05171 Coronavirus disease - COVID-19
    100990245 (PRKCG)
   05163 Human cytomegalovirus infection
    100990245 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100990245 (PRKCG)
   05143 African trypanosomiasis
    100990245 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100990245 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    100990245 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    100990245 (PRKCG)
   05032 Morphine addiction
    100990245 (PRKCG)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100990245 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100990245 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100990245 (PRKCG)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100990245 (PRKCG)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100990245 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C ABC1 Kinase-like APH
Other DBs
NCBI-GeneID: 100990245
NCBI-ProteinID: XP_008953806
Position
19
AA seq 695 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWXGAGLGPGDGAQYYHLHLPDFQAEGS
MPLALSFSFPQRVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKGSF
GKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHS
TFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLK
LDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFG
VLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGP
DGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVL
ASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggctggtctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggtatcgga
aagcagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgagttt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaaa
cacaagttccgcctgcatagctacagcagccccaccttctgcgaccactgtggctccctc
ctctacgggcttgtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgtagcgtgccctccctgtgcggtgtggaccacactgagcgccgcgggcgc
ctgcagctggagatccgggctcccacagcagatgagatccacgtaactgttggcgaggcc
cgtaacctaattcctatggaccccaatggtctctctgatccctatgtgaaactgaagctc
atcccagaccctcggaacctgacgaaacagaagacccgaacagtgaaagccacgctaaac
cctgtgtggaatgagacctttgtgttcaacctgaagccaggggatgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggggccatgtcc
tttggcgtctcggagctgctcaaggcgcccgtggatggctggtgaggagcagggctgggg
cctggggatggagcgcaatattaccatctccatctaccagattttcaggcagaaggaagt
atgcctctggctctttctttctcctttccacagcgggtgcggatgggcccctcttcctct
cccatcccctccccttcccctagtcccaccgaccccaagcgctgcttcttcggggcgagc
ccaggacgcctgcacatctccgacttcagcttcctcatggttctaggaaaaggcagtttt
gggaaggtgatgctggccgagcgcaggggctctgatgagctctacgccatcaagatcttg
aaaaaggacgtgatcgtccaggacgacgatgtggactgcacgctggtggagaaacgtgtg
ctggcgctggggggccggggtcctggcggccggccccacttcctcacccagctccactcc
accttccagaccccggaccgcctgtatttcgtgatggagtacgtcaccgggggagacttg
atgtaccacattcaacagctgggcaagtttaaggagccccatgcagcgttctacgcggca
gaaatcgctatcggcctcttcttccttcacaatcagggcatcatctacagggacctgaag
ctggacaatgtgatgctggatgctgagggacacatcaagatcactgacttcggcatgtgt
aaggagaatgtcttccccgggacgacaacccgcaccttctgcgggaccccggactacata
gccccggagatcattgcctaccagccctatgggaagtctgtcgattggtggtcctttgga
gttctgctgtatgagatgttggcaggacagcctcccttcgatggggaggacgaggaggag
ctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgggaagcc
gtggccatctgcaaggggttcctgaccaagcacccagggaagcgcctgggctcagggcct
gatggggaacctaccatccgtgcacatggctttttccgctggattgactgggagcggctg
gaacgattggagatcccgcctcctttcagaccccgcccgtgtggccgcagcggcgagaac
tttgacaagttcttcacgcgggcggcgccagcgctgacccctccagaccgcctagtcctg
gccagcatcgaccaggccgatttccagggcttcacctacgtgaaccccgacttcgtgcac
ccggatgcccgcagccccaccagcccagtgcctgtgcccgtcatgtaa

DBGET integrated database retrieval system