KEGG   Pan paniscus (bonobo): 100967985
Entry
100967985         CDS       T02283                                 

Gene name
DDX58
Definition
(RefSeq) DExD/H-box helicase 58
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:3.6.4.13]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04064  NF-kappa B signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05164  Influenza A
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100967985 (DDX58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100967985 (DDX58)
   04623 Cytosolic DNA-sensing pathway
    100967985 (DDX58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100967985 (DDX58)
   05160 Hepatitis C
    100967985 (DDX58)
   05171 Coronavirus disease - COVID-19
    100967985 (DDX58)
   05164 Influenza A
    100967985 (DDX58)
   05162 Measles
    100967985 (DDX58)
   05168 Herpes simplex virus 1 infection
    100967985 (DDX58)
   05169 Epstein-Barr virus infection
    100967985 (DDX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pps04054]
    100967985 (DDX58)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100967985 (DDX58)
Pattern recognition receptors [BR:pps04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   100967985 (DDX58)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD DEAD ResIII Helicase_C AAA_22 AAA_25 Syntaxin_2 ATP-synt_ab
Other DBs
NCBI-GeneID: 100967985
NCBI-ProteinID: XP_003830148
UniProt: A0A2R9CAP6
Position
9
AA seq 925 aa
MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKF
LLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIP
TDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERN
KFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSP
FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQI
PVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTI
PSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNT
DEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMR
DTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFL
YTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESV
SRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPSI
LTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGN
VIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKI
LHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKE
CFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATG
VQTLYSKWKDFHFEKIPFDPAEMSK
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgaccaccgagcagcggcgcagcctgcaagccttccaggattatatccggaagaccctg
gaccctacctacatcctgagctacatggccccctggtttagggaggaagaggtgcagtat
attcaggctgagaaaaacaacaagggcccaatggaggctgccacactttttctcaagttc
ctgttggagctccaggaggaaggctggttccgtggctttttggatgccctagaccatgca
ggttattctggactttatgaagccattgaaagttgggatttcaaaaaaattgaaaaattg
gaggagtatagattacttttaaaacgtttacaaccagaatttaaaaccagaattatccca
accgatatcatttctgatctgtctgaatgtttaattaatcaggaatgtgaagaaattcta
cagatttgctctactaaggggatgatggcaggtgcagagaaattggtggaatgccttctc
agatcagacaaggaaaactggcccaaaactttgaaacttgctttggagaaagaaaggaac
aagttcagtgaactgtggattgtagagaaaggtataaaagatgttgaaacagaagatctt
gaggataagatggaaacttctgacatacagattttctaccaagaagatccagaatgccag
aatcttagtgagaattcatgtccaccttcagaagtgtctgatacaaacttgtacagccca
tttaaaccaagaaattaccaattagagcttgctttgcctgctatgaaaggaaaaaacaca
ataatatgtgctcctacaggttgtggaaaaacctttgtttcactgcttatatgtgaacat
catcttaaaaaattcccacaaggacaaaaggggaaagttgtcttttttgctaatcagatc
ccagtgtatgaacagcagaaatctgtattctcaaaatactttgaaagacatgggtataga
gtcacaggcatttctggagcaacagctgagaatgtcccagtggaacagattgttgagaac
aatgacatcatcattttaactccacagattcttgtgaacaaccttaaaaagggaacgatt
ccatcactatccatctttactttgatgatatttgatgaatgccacaacactagtaaacaa
cacccgtacaatatgatcatgtttaattatctagatcagaaacttggaggatcttcaggc
ccactgccccaggtcattgggctgactgcctcggttggtgttggggatgccaaaaacaca
gatgaagccttggattatatctgcaagctgtgtgcttctcttgatgcgtcagtgatagca
acagtcaaacacaatctggaggaactggagcaagttgtttataagccccagaagtttttc
aggaaagtggaatcacggattagcgacaaatttaaatacatcatagctcagctgatgagg
gacacagagagcctggcaaagagaatctgcaaagacctcgaaaacttatctcaaattcaa
aatagggaatttggaacacagaaatatgaacaatggattgttacagttcagaaagcatgc
atggtgttccagatgccagacaaagatgaagagagcaggatttgtaaagccctgttttta
tacacttcacatttgcggaaatataatgatgccctcattatcagtgagcatgcacgaatg
aaagatgctctggattacttgaaagacttcttcagcaatgtccgagcagcaggattcgat
gagattgagcaagatcttactcagagatttgaagaaaagctgcaggaactagaaagtgtt
tccagggatcccagcaatgagaatcctaaacttgaagacctctgcttcatcttacaagaa
gagtaccacttaaacccagagacaataacaattctctttgtgaaaaccagagctcttgtg
gacgctttaaaaaattggattgaaggaaatcctaaactcagttttctaaaacctagcata
ttgactggacgtggcaaaacaaatcagaacacaggaatgaccctcccggcacagaagtgt
atattggatgcattcaaagccagtggagatcacaatattctgattgccacctcagttgct
gatgaaggcattgacattgcacagtgcaatcttgtcatcctttatgagtatgtgggcaat
gtcatcaaaatgatccaaaccagaggcagaggaagagcaagaggtagcaagtgcttcctt
ctgactagtaatgctggtgtaattgaaaaagaacaaataaacatgtacaaagaaaaaatg
atgaatgactctattttacgccttcagacatgggacgaagcagtatttagggaaaagatt
ctgcatatacagactcatgaaaaattcatcagagatagtcaagaaaaaccaaaacccgta
cctgataaggaaaataaaaaactgctctgcagaaagtgcaaagccttggcatgttacaca
gctgacgtaagagtgatagaggaatgccattacactgtgcttggagatgcttttaaggaa
tgctttgtgagtagaccacatcccaagccaaagcagttttcaagttttgaaaaaagagca
aagatattctgtgcccgacagaactgcagccatgactggggaatccatgtgaagtataag
acatttgagattccagttataaaaattgaaagttttgtggtggaggatattgcaactgga
gttcagacactgtactcgaagtggaaggactttcattttgagaagataccatttgatcca
gcagaaatgtccaaatga

DBGET integrated database retrieval system