KEGG   Pan paniscus (bonobo): 100968079
Entry
100968079         CDS       T02283                                 

Gene name
GRM1
Definition
(RefSeq) glutamate metabotropic receptor 1
  KO
K04603  metabotropic glutamate receptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04068  FoxO signaling pathway
pps04072  Phospholipase D signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04540  Gap junction
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04730  Long-term depression
pps04742  Taste transduction
pps04915  Estrogen signaling pathway
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100968079 (GRM1)
   04020 Calcium signaling pathway
    100968079 (GRM1)
   04072 Phospholipase D signaling pathway
    100968079 (GRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100968079 (GRM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100968079 (GRM1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100968079 (GRM1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100968079 (GRM1)
   04720 Long-term potentiation
    100968079 (GRM1)
   04730 Long-term depression
    100968079 (GRM1)
   04723 Retrograde endocannabinoid signaling
    100968079 (GRM1)
  09157 Sensory system
   04742 Taste transduction
    100968079 (GRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100968079 (GRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    100968079 (GRM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100968079 (GRM1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100968079 (GRM1)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100968079 (GRM1)
G protein-coupled receptors [BR:pps04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   100968079 (GRM1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438 FtrD-like AAA_34
Other DBs
NCBI-GeneID: 100968079
NCBI-ProteinID: XP_003811578
UniProt: A0A2R9CQ41
Position
6
AA seq 1194 aa
MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEYVQDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNANSNGKSVSWSEPGG
GQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE
EDAQPIRFSPPGSPSMVVHRRVPSAATTPPLPPHLTAEETPLFLAEPALPKGLPPPLQQQ
QQPPPQQKSLMDQLQGVVSNFSTAIPDFHAVLAGPGGPGNGLRSLYPPPPPPQHLQMLPL
QLSTFGEEPVSPPADDDDDSERFKLLQEYVYEHEREGNTEEDELEEEEEDLQAASKLTPD
DSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVSYASVILRDYKQSSSTL
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggtcgggctcctcttgttttttttcccagcgatctttttggaggtgtcccttctcccc
agaagccccggcaggaaagtgttgctggcaggagcgtcgtctcagcgctcggtggccaga
atggacggagatgtcatcattggagccctcttctcagtccatcaccagcctccggccgag
aaagtgcccgagaggaagtgtggggagatcagggagcagtatggcatccagagggtggag
gccatgttccacacgttggataagatcaacgcggacccggtcctcctgcccaacatcacc
ctgggcagtgagatccgggactcctgctggcactcttccgtggctctggaacagagcatt
gagttcattagggactctctgatttccattcgagatgagaaggatgggatcaaccggtgc
ctgcctgacggccagtccctccccccaggcagaactaagaagcccattgcgggagtgatc
ggtcccggctccagctctgtagccattcaagtgcagaacctgctccagctcttcgacatc
ccccagatcgcttattcagctacaagcatcgacctgagtgacaaaactttgtacaaatac
ttcctgagggttgtcccttctgacactttgcaggcaagggccatgcttgacatagtcaaa
cgttacaattggacctatgtctctgcagtccacacggaagggaattatggggagagcgga
atggacgctttcaaagagctggctgcccaggaaggcctctgcatcgcccattctgacaaa
atctacagcaacgctggggagaagagctttgaccgactcttgcgcaaactccgagagagg
cttcccaaggctagagtggtggtctgcttctgtgaaggcatgacagtgcgaggactcctg
agcgccatgcggcgccttggcgtcgtgggcgagttctcactcattggaagtgatggatgg
gcagacagagatgaagtcattgaaggttatgaggtggaagccaacgggggaatcacgata
aagctgcagtctccagaggtcaggtcatttgatgattatttcctgaaactgaggctggac
actaacacgaggaatccctggttccctgagttctggcaacatcggttccagtgccgcctt
ccaggacaccttctggaaaatcccaactttaaacgaatctgcacaggcaatgaaagctta
gaagaaaactatgtccaggacagtaagatggggtttgtcatcaatgccatctatgccatg
gcacatgggctgcagaacatgcaccatgccctctgccctggccacgtgggcctctgcgat
gccatgaagcccatcgacggcagcaagctgctggacttcctcatcaagtcctcattcatt
ggagtatctggagaggaggtgtggtttgatgagaaaggagacgctcctggaaggtatgat
atcatgaatctgcagtacactgaagctaatcgctatgactatgtgcacgttggaacctgg
catgaaggagtgctgaacattgatgattacaaaatccagatgaacaagagtggagtggtg
cggtctgtgtgcagtgagccttgcttaaagggccagattaaggttatacggaaaggagaa
gtgagctgctgctggatttgcacggcctgcaaagagaatgaatatgtgcaagatgagttc
acctgcaaagcttgtgacttgggatggtggcccaatgcagatctaacaggctgtgagccc
attcctgtgcgctatcttgagtggagcaacatcgaatccattatagccatcgccttttca
tgcctgggaatccttgttaccttgtttgtcaccctaatctttgtactgtaccgggacaca
ccagtggtcaaatcctccagtcgggagctctgctacatcatcctagctggcatcttcctt
ggttatgtgtgcccattcactctcattgccaaacctactaccacctcctgctacctccag
cgcctcttggttggcctctcctctgcgatgtgctactctgctttagtgactaaaaccaat
cgcattgcacgcatcctggctggcagcaagaagaagatctgcacccggaagcccaggttc
atgagtgcctgggctcaagtgatcattgcctcaattctgattagtgtgcaactaaccctg
gtggtaaccctgatcatcatggaaccccctatgcccattctgtcctacccaagtatcaag
gaagtctatcttatctgcaataccagcaacctgggtgtggtggcccctttgggctacaat
ggactcctcatcatgagctgtacctactatgccttcaagacccgcaacgtgcccgccaac
ttcaacgaggccaaatatatcgccttcaccatgtacaccacctgtatcatctggctagct
tttgtgcccatttactttgggagcaactacaagatcatcacaacttgctttgcagtgagt
ctcagtgtaacagtggctctggggtgcatgttcactcccaagatgtacatcattattgcc
aagcctgagaggaatgtccgcagtgccttcaccacctctgatgttgtccgcatgcatgtt
ggcgatggcaagctgccctgccgctccaacactttcctcaacatcttccgaagaaagaag
gcaggggcagggaatgccaattctaatggcaagtctgtgtcatggtctgaaccaggtgga
ggacaggtgcccaagggacagcatatgtggcaccgcctctctgtgcacgtgaagaccaat
gagacggcctgcaaccaaacagccgtcatcaagcccctcactaaaagttaccaaggctct
ggcaagagcctgaccttttcagataccagcaccaagaccctttacaacgtagaggaggag
gaggatgcccagccgattcgctttagcccgcctggtagcccttccatggtggtgcacagg
cgcgtgccaagcgcggcgaccactccgcctctgccgccccacctgaccgcagaggagacc
cccctcttcctggccgaaccagccctccccaagggcttgccccctcctctccagcagcag
cagcaaccccctccacagcagaaatcgctgatggaccagctccagggagtggtcagcaac
ttcagtaccgcgatcccggattttcacgcggtgctggcaggccccgggggtcccgggaac
gggctgcggtccctgtacccgcccccgccacctccgcagcacctgcagatgctgccgctg
cagctgagcaccttcggggaggagccggtctccccgcccgcggacgacgacgacgacagc
gagaggtttaagctcctccaggagtacgtgtatgagcacgagcgggaagggaacacggaa
gaagacgaactggaagaggaggaggaggacctgcaggcggccagcaaactgaccccggat
gattcgcctgcgctgacgcctccgtcgcctttccgcgactcggtggcctcgggcagctcg
gtgcccagctcccccgtgtccgagtcggtgctctgcacccctcccaacgtatcctacgcc
tctgtcattctgcgggactacaagcaaagctcttccaccctgtaa

KEGG   Pan paniscus (bonobo): 100968161
Entry
100968161         CDS       T02283                                 

Gene name
CXCR4
Definition
(RefSeq) C-X-C motif chemokine receptor 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04144  Endocytosis
pps04360  Axon guidance
pps04670  Leukocyte transendothelial migration
pps04672  Intestinal immune network for IgA production
pps04810  Regulation of actin cytoskeleton
pps05163  Human cytomegalovirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100968161 (CXCR4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100968161 (CXCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100968161 (CXCR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100968161 (CXCR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100968161 (CXCR4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100968161 (CXCR4)
   04672 Intestinal immune network for IgA production
    100968161 (CXCR4)
   04062 Chemokine signaling pathway
    100968161 (CXCR4)
  09158 Development and regeneration
   04360 Axon guidance
    100968161 (CXCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100968161 (CXCR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100968161 (CXCR4)
   05163 Human cytomegalovirus infection
    100968161 (CXCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100968161 (CXCR4)
   04050 Cytokine receptors [BR:pps04050]
    100968161 (CXCR4)
   04090 CD molecules [BR:pps04090]
    100968161 (CXCR4)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100968161 (CXCR4)
Cytokine receptors [BR:pps04050]
 Chemokine receptors
  CXC Chemokine
   100968161 (CXCR4)
CD molecules [BR:pps04090]
 Proteins
  100968161 (CXCR4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx Cybc1_Eros
Other DBs
NCBI-GeneID: 100968161
NCBI-ProteinID: XP_003822867
UniProt: A0A2R9CH84
Position
2B
AA seq 352 aa
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggaggggatcagtatatacacttcagataactacaccgaggaaatgggctcaggggac
tatgactccatgaaggaaccctgtttccgtgaagaaaatgctaatttcaataaaatcttc
ctgcccaccatctactccatcatcttcttgactggcattgtgggcaatggattggtcatc
ctggtcatgggttaccagaagaaactgagaagcatgacggacaagtacagactgcacctg
tcagtggccgacctcctctttgtcatcacgcttcccttctgggcagttgatgccgtggca
aactggtactttgggaacttcctatgcaaggcagtccatgtcatctacacagtcaacctc
tacagcagtgtcctcatcctggccttcatcagtctggaccgctacctggccattgtccac
gccaccaacagtcagaggccaaggaagctgttggctgaaaaggtggtctatgttggcgtc
tggatccctgccctcctgcttactattcccgacttcatctttgccaacgtcagtgaggca
gatgacagatatatctgtgaccgcttctaccccaatgacttgtgggtggttgtgttccag
tttcagcacatcatggttggccttatcctgcctggtattgtcatcctgtcctgctattgc
attatcatctccaagctgtcacactccaagggccaccagaagcgcaaggccctcaagacc
acagtcatcctcatcctggctttcttcgcctgttggctgccttactacattgggatcagc
atcgactccttcatcctcctggaaatcatcaagcaagggtgtgagtttgagaacactgtg
cacaagtggatttccatcaccgaggccctagctttcttccactgttgtctgaaccccatc
ctctatgctttccttggagccaaatttaaaacctctgcccagcacgcactcacctctgtg
agcagagggtccagcctcaagatcctctccaaaggaaagcgaggtggacattcatctgtt
tccactgagtctgagtcttcaagttttcactccagctaa

KEGG   Pan paniscus (bonobo): 100968812
Entry
100968812         CDS       T02283                                 

Gene name
EDNRA
Definition
(RefSeq) endothelin receptor type A
  KO
K04197  endothelin receptor type A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04270  Vascular smooth muscle contraction
pps04924  Renin secretion
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100968812 (EDNRA)
   04024 cAMP signaling pathway
    100968812 (EDNRA)
   04022 cGMP-PKG signaling pathway
    100968812 (EDNRA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100968812 (EDNRA)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100968812 (EDNRA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100968812 (EDNRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100968812 (EDNRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100968812 (EDNRA)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Endothelin
    100968812 (EDNRA)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100968812
NCBI-ProteinID: XP_008967127
UniProt: A0A2R9BHM9
Position
4
AA seq 427 aa
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDSTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccctttgcctcagggcatccttttggctggcactggttggatgtgtaatcagt
gataatcctgagagatacagcacaaatctaagcaatcatgtggatgattccaccactttt
cgtggcacagagctcagcttcctggttaccactcatcaacccactaatttggtcctaccc
agcaatggctcaatgcacaactattgcccacagcagactaaaattacttcagctttcaaa
tacattaacactgtgatatcttgtactattttcatcgtgggaatggtggggaatgcaact
ctgctcaggatcatttaccagaacaaatgtatgaggaatggccccaacgcgctgatagcc
agtcttgcccttggagaccttatctatgtggtcattgatctccctatcaatgtatttaag
ctgctggctgggcgctggccttttgatcacaatgactttggcgtatttctttgcaagctg
ttcccctttttgcagaagtcctcggtggggatcaccgtcctcaacctctgcgctcttagt
gttgacaggtacagagcagttgcctcctggagtcgtgttcagggaattgggattcctttg
gtaactgccattgaaattgtctccatctggatcctgtccttcatcctggccattcctgaa
gcgattggcttcgtcatggtaccctttgaatataggggtgaacagcataaaacctgtatg
ctcaatgccacatcaaaattcatggagttctaccaagatgtaaaggactggtggctcttc
gggttctatttctgtatgcccttggtgtgcactgcgatcttctacaccctcatgacttgt
gagatgttgaacagaaggaatggcagcttgagaattgccctcagtgaacatcttaagcag
cgtcgagaagtggcaaaaacagttttctgcttggttgtaatttttgctctttgctggttc
cctcttcatttaagccgtatattgaagaaaactgtgtataatgagatggacaagaaccga
tgtgaattacttagtttcttactgctcatggattacatcggtattaacttggcaaccatg
aattcatgtataaaccccatagctctgtattttgtgagcaagaaatttaaaaattgtttc
cagtcatgcctctgctgctgctgttaccagtccaaaagtctgatgacctcggtccccatg
aacggaacaagcatccagtggaagaaccacgatcaaaacaaccacaacacagaccggagc
agccataaggatagcatgaactga

KEGG   Pan paniscus (bonobo): 100970551
Entry
100970551         CDS       T02283                                 

Gene name
TACR2
Definition
(RefSeq) tachykinin receptor 2
  KO
K04223  tachykinin receptor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100970551 (TACR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100970551 (TACR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100970551 (TACR2)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Tachykinin
    100970551 (TACR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 100970551
NCBI-ProteinID: XP_003815973
Position
10
AA seq 398 aa
MGTCDIVTEANISSGPESNTTGTTAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPGTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAKKKFVKTMVLVVVTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWATPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDAAPSEATSGEAGCPQDGSGLWFGYGLLAPTKTHVEI
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggggacctgtgacattgtgactgaagccaatatctcatctggccctgagagcaacacc
acgggcaccacagccttctccatgcccagctggcaactggcactgtgggccacagcctac
ctggccctggtgctggtggccgtgacgggtaatgccatcgtcatctggatcatcctggcc
catcggaggatgcgcacagtcaccaactacttcatcgtcaatctggcgctggctgacctc
tgcatggctgccttcaatgccgccttcaactttgtctatgccagccacaacatctggtac
tttggccgtgccttctgctacttccagaacctcttccccatcacagccatgtttgtcagc
atctactccatgaccgccattgctgccgacaggtacatggccatcgtccaccccttccag
cctcggctttcagcccccggcaccaaggcggttattgctggcatctggctggtggctctc
gccctggcctccccccagtgcttctactccaccgtcaccatggaccagggtgccaccaag
tgcgtggtggcctggcctgaagacagcgggggcaagacgctcctcctgtaccacctcgtg
gtgatcgccctcatctacttcctgccgctcgcggtgatgttcgtcgcctacagcgtcatc
ggcctcacgctctggaggcgcgcagtgcccggacatcaggcgcacggtgccaacctgcgc
cacctgcaggccaagaagaagtttgtgaagaccatggtgctggtggtggtgacgtttgcc
atctgctggctgccctaccacctctacttcatcctgggcagcttccaggaggacatctac
tgccacaagttcatccagcaagtctacctggcactcttctggttggccatgagctctacc
atgtacaatcccatcatctactgctgcctcaaccacaggtttcgctctggattccggctt
gccttccgctgctgcccatgggccacacccaccaaggaagataagctcgagctgactccc
acgacctccctctccacaagagtcaacaggtgtcacactaaggagactttgttcatggct
ggggacgcagccccctccgaggctaccagtggggaggcggggtgtccccaggatggatca
gggctatggtttgggtatggtttgcttgcccccaccaaaactcatgttgaaatttga

KEGG   Pan paniscus (bonobo): 100970741
Entry
100970741         CDS       T02283                                 

Gene name
HTR2A
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04540  Gap junction
pps04726  Serotonergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100970741 (HTR2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100970741 (HTR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100970741 (HTR2A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100970741 (HTR2A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100970741 (HTR2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100970741 (HTR2A)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100970741 (HTR2A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100970741
NCBI-ProteinID: XP_003811462
UniProt: A0A2R8Z5S4
Position
13
AA seq 471 aa
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDIIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggatattctttgtgaagaaaatacttctttgagctcaactacaaactccctaatgcaa
ttaaatgatgacaccaggctctacagtaatgactttaactccggagaagctaacacttct
gatgcatttaactggacagtcgactctgaaaatcgaaccaacctttcctgtgaagggtgc
ctctcaccatcgtgtctctccttacttcatctccaggaaaaaaactggtctgctttactg
acagctgtagtgattattctaactattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctctgccgagcaagctttgcgcagtctggatttacctggacgtgctcttctccacg
gcctccatcatgcacctctgcgccatctcgctggaccgctacgtcgccatccagaatccc
atccaccatagccgcttcaactccagaactaaggcatttctgaaaatcattgctgtttgg
accatatcagtaggtatatccatgccaataccagtctttgggctacaggacgattcgaag
gtctttaaggaggggagttgcttactcgctgatgataactttgtcctgatcggctctttt
gtgtcatttttcattcccttaaccatcatggtgatcacctactttctaactatcaagtca
ctccagaaagaagctactttgtgtgtaagtgatcttggcacacgggccaaattagcttct
ttcagcttcctccctcagagttctttgtcttcagaaaagctcttccagcggtcgatccat
agggagccagggtcctacacaggcaggaggactatgcagtccatcagcaatgagcaaaag
gcatgcaaggtgctgggcatcgtcttcttcctgtttgtggtgatgtggtgccctttcttc
atcacgaacatcatggccgtcatctgcaaagagtcctgcaatgaggatatcattggggcc
ctgctcaatgtgtttgtttggatcggttatctctcttcagcagtcaacccactagtctac
acactgttcaacaagacctataggtcagccttttcacggtatattcagtgtcagtacaag
gaaaacaaaaaaccattgcagttaattttagtgaacactataccggctttggcctacaag
tctagccaacttcaaatgggacaaaaaaagaattcaaagcaagatgccaagacaacagat
aatgactgctcaatggttgctctaggaaagcagcattctgaagaggcttctaaagacaat
agcgacggagtgaatgaaaaggtgagctgtgtgtga

KEGG   Pan paniscus (bonobo): 100970743
Entry
100970743         CDS       T02283                                 

Gene name
CHRM1
Definition
(RefSeq) cholinergic receptor muscarinic 1
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04151  PI3K-Akt signaling pathway
pps04725  Cholinergic synapse
pps04810  Regulation of actin cytoskeleton
pps05010  Alzheimer disease
pps05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100970743 (CHRM1)
   04024 cAMP signaling pathway
    100970743 (CHRM1)
   04151 PI3K-Akt signaling pathway
    100970743 (CHRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100970743 (CHRM1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100970743 (CHRM1)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100970743 (CHRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100970743 (CHRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    100970743 (CHRM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100970743 (CHRM1)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    100970743 (CHRM1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100970743
NCBI-ProteinID: XP_003828561
UniProt: A0A2R8ZHH8
Position
11
AA seq 460 aa
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaacacttcagccccacctgctgtcagccccaacatcaccgtcctggcaccaggaaag
ggtccctggcaagtggccttcattgggatcaccacgggccttctgtcgctagccacagtg
acaggcaacctgctggtactcatctctttcaaggtcaacacggagctcaagacagtcaat
aactacttcctgctgagcctggcctgtgctgacctcatcatcggtaccttctccatgaac
ctctataccacgtacctgctcatgggccactgggctctgggcacgctggcttgtgacctc
tggctggccctggactatgtggccagcaatgcctccgtcatgaatctgctgctcatcagc
tttgaccgctacttctccgtgactcggcccctgagctaccgtgccaagcgcacaccccgc
cgggcagctctgatgatcggcctggcctggctggtttcctttgtgctctgggccccagcc
atcctcttctggcagtacctggtaggggagcggacagtgctagctgggcagtgctacatc
cagttcctctcccagcccatcatcacctttggcacagccatggctgccttctacctccct
gtcacagtcatgtgcacgctctactggcgcatctaccgggagacagagaaccgagcacgg
gagctggcagcccttcagggctctgagacgccaggcaaagggggtggcagcagcagcagc
tcagagaggtctcagccaggggctgagggctcaccagagactcctccaggccgctgctgt
cgctgctgccgggcccccaggctgctgcaggcctacagctggaaggaagaagaggaagag
gacgaaggctccatggagtccctcacatcctcagagggagaggagcctggctccgaagtg
gtgatcaagatgccaatggtggaccccgaggcacaggcccccaccaagcagcccccacgg
agctccccaaatacagtcaagaggccgactaagaaagggcgtgatcgagctggcaagggc
cagaagccccgtggaaaggagcagctggccaagcggaagaccttctcgctggtcaaggag
aagaaggcggctcggaccctgagtgccatcctcctggccttcatcctcacctggacaccg
tacaacatcatggtgctggtgtccaccttctgcaaggactgtgttcccgagaccctgtgg
gagctgggctactggctgtgctacgtcaacagcaccatcaaccccatgtgctacgcactc
tgcaacaaagccttccgggacacctttcgcctgctgctgctttgccgctgggacaagaga
cgctggcgcaagatccccaagcgccctggctccgtgcaccgcactccctcccgccaatgc
tga

KEGG   Pan paniscus (bonobo): 100972150
Entry
100972150         CDS       T02283                                 

Gene name
BDKRB2
Definition
(RefSeq) bradykinin receptor B2
  KO
K03916  bradykinin receptor B2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04071  Sphingolipid signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04610  Complement and coagulation cascades
pps04750  Inflammatory mediator regulation of TRP channels
pps04810  Regulation of actin cytoskeleton
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps05142  Chagas disease
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100972150 (BDKRB2)
   04071 Sphingolipid signaling pathway
    100972150 (BDKRB2)
   04022 cGMP-PKG signaling pathway
    100972150 (BDKRB2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100972150 (BDKRB2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100972150 (BDKRB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100972150 (BDKRB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100972150 (BDKRB2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100972150 (BDKRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972150 (BDKRB2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100972150 (BDKRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100972150 (BDKRB2)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Bradykinin
    100972150 (BDKRB2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 100972150
NCBI-ProteinID: XP_008956531
UniProt: A0A2R9AXX3
Position
14
AA seq 391 aa
MFSPWKIPMFLSVREDSVPTTASFSTDMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
IQMENSMGTLRTSISVERQIHKLQDWAGSRQ
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgttctctccctggaagataccaatgtttctctctgttcgtgaggactctgtgcccacc
acggcctctttcagcaccgacatgctcaatgtcaccttgcaagggcccactcttaacggg
acatttgcccagagcaaatgcccccaagtggagtggctgggctggctcaacaccatccag
ccccccttcctctgggtgctgttcgtgctggccaccctagagaacatctttgtcctcagc
gtcttctgcctgcacaagagcagctgcacggtggcagagatctacctggggaacctggcc
gcagcagacctgatcctggcctgcgggctgcccttctgggccatcaccatctccaacaac
ttcgactggctctttggggagacgctctgccgcgtggtgaatgccattatctccatgaac
ctgtacagcagcatctgtttcctgatgctggtgagcatcgaccgctacctggccctggtg
aaaaccatgtccatgggccggatgcgcggcgtgcgctgggccaagctctacagcttggtg
atctgggggtgtacgctgctcctgagctcacccatgctggtgttccggaccatgaaggag
tacagcgatgagggccacaacgtcaccgcttgtgtcatcagctacccatccctcatctgg
gaagtgttcaccaacatgctcctgaatgtcgtgggcttcctgctgcccctgagtgtcatc
accttctgcacgatgcagatcatgcaggtgcttcggaacaacgagatgcagaagttcaag
gagatccagacggagaggagggccacggtgctagtcctggttgtgctgctgctattcatc
atctgctggctgcccttccagatcagcaccttcctggatacgctgcatcgccttggcatc
ctctccagctgccaggacgagcgcatcatcgatgtaatcacacagatcgcctccttcatg
gcctacagcaacagctgcctcaacccactggtgtacgtgatcgtgggcaagcgcttccga
aagaagtcttgggaggtgtaccagggagtgtgccagaaagggggctgcaggtcagaaccc
attcagatggagaactccatgggcacactgcggacctccatctccgtggaacgccagatt
cacaaactgcaggactgggcagggagcagacagtga

KEGG   Pan paniscus (bonobo): 100972709
Entry
100972709         CDS       T02283                                 

Gene name
BDKRB1
Definition
(RefSeq) bradykinin receptor B1
  KO
K03915  bradykinin receptor B1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04610  Complement and coagulation cascades
pps04750  Inflammatory mediator regulation of TRP channels
pps04810  Regulation of actin cytoskeleton
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100972709 (BDKRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100972709 (BDKRB1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100972709 (BDKRB1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100972709 (BDKRB1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100972709 (BDKRB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972709 (BDKRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100972709 (BDKRB1)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Bradykinin
    100972709 (BDKRB1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 100972709
NCBI-ProteinID: XP_003832889
Position
14
AA seq 353 aa
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAETIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRRQEEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggcatcatcctggccccctctagagctccaatcctccaaccagagccagctcttccct
caaaatgctacggcctgtgacaatgctccagaagcctgggacctgctgcacagagtgctg
ccgacatttatcatctccatctgtttcttcggcctcctagggaacctttttgtcctgttg
gtcttcctcctgccccggcggcaactgaacgtggcagaaatctacctggccaacctggca
gcctctgatctggtgtttgtcttgggcttgcccttctgggcagagactatctggaaccag
tttaactggcctttcggagccctcctctgccgtgtcatcaacggggtcatcaaggccaat
ttgttcatcagcatcttcctggtggtggccatcagccaggaccgctaccgcgtgctggtg
caccctatggccagccggaggcagcagcggcggaggcaggcccgggtcacctgcgtgctc
atctgggttgtggggggcctcttgagcatccccacattcctgctgcgatccatccaagcc
gtcccagatctgaacatcaccgcctgcatcctgctcctcccccatgaggcctggcacttt
gcaaggattgtggagttaaatattctgggtttcctcctaccactggctgcgatcgtcttc
ttcaactaccacatcctggcctccctgcgaaggcaggaggaggtcagcaggacaaggtgc
gggggccgcaaggatagcaagaccacagcgctgatcctcacgctcgtggttgccttcctg
gtctgctgggccccttaccacttctttgccttcctggaattcttattccaggtgcaagca
gtccgaggctgcttttgggaggacttcattgacctgggcctgcaattggccaacttcttt
gccttcactaacagctccctgaatccagtaatttatgtctttgtgggccggctcttcagg
accaaggtctgggaactttataaacaatgcacccctaaaagtcttgctccaatatcttca
tcccataggaaagaaatcttccaacttttctggcggaattaa

KEGG   Pan paniscus (bonobo): 100975934
Entry
100975934         CDS       T02283                                 

Gene name
PTGER1
Definition
(RefSeq) prostaglandin E receptor 1
  KO
K04258  prostaglandin E receptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps05163  Human cytomegalovirus infection
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100975934 (PTGER1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100975934 (PTGER1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100975934 (PTGER1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100975934 (PTGER1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100975934 (PTGER1)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    100975934 (PTGER1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 100975934
NCBI-ProteinID: XP_003807133
Position
19
AA seq 210 aa
MATCCPSCVPGLFSLISLTTRISKSGWSWGRLQASGAGIWSGTVGTQGEAEVIGVGPAGV
AGGARTRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLVGIMVVSCICWSP
MLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLRQLLRLLPPRAGA
KGGPAGLGLTPSAWEASSLRSSRHSGLSHF
NT seq 633 nt   +upstreamnt  +downstreamnt
atggccacctgctgtccgtcctgtgtccccgggctcttctccctgatctccctcaccacc
aggatatcaaagagtggatggtcgtggggccgcctccaggcctctggggcagggatatgg
agtggaaccgtgggcacccagggtgaggcagaggtgatcggggtagggcctgccggcgtc
gctgggggcgcgcggacccgctcggcctccgcctcgtccgcctcgtccatcgcttcggcc
tccaccttctttggcggctctcggagcagcggctcggcacgcagagctcgcgcccacgac
gtggagatggtgggccagcttgtcggtatcatggtggtgtcgtgcatctgctggagccca
atgctggtgttggtggcgctggcggtcggcggctggagctctacctccctgcagcggcca
ctgttcctggccgtgcgccttgcctcctggaaccagatcctggacccttgggtgtacatc
ctactgcgccaggccgtgctgcgccaactgcttcgcctcctgcccccgagggccggggcc
aagggcggccccgcggggctgggcctaacaccgagcgcctgggaggccagctcgctgcgc
agctcccggcacagcggcctcagccacttctaa

KEGG   Pan paniscus (bonobo): 100976535
Entry
100976535         CDS       T02283                                 

Gene name
CYSLTR2
Definition
(RefSeq) cysteinyl leukotriene receptor 2
  KO
K04323  cysteinyl leukotriene receptor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100976535 (CYSLTR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100976535 (CYSLTR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100976535 (CYSLTR2)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Lipid
   Cysteinyl leukotriene
    100976535 (CYSLTR2)
SSDB
Motif
Pfam: 7tm_1 TAS2R 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100976535
NCBI-ProteinID: XP_003811477
UniProt: A0A2R8Z7S0
Position
13
AA seq 346 aa
MERKFMSLHPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFVWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV
NMYSSIYFLTVLSVVRFLATVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ
NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV
SHRKALTTIIITLIIFFLCFLPYHTLRTIHLATWKVGICKDRLHKAVVITLALAAANTCF
NPLLYYFAGENFKDRLRSALRKGHPQKAKTKCVFPVSVWLRKETRV
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagagaaaatttatgtccttgcatccatccatctccgtatcagaaatggaaccaaat
ggcaccttcagcaataacaacagcaggaactgcacaattgaaaacttcaagagagaattt
ttcccaattgtatatctgataatatttgtctggggagtcttgggaaatgggttgtccata
tatgttttcctgcagccttataagaagtccacatctgtgaacgttttcatgctaaatctg
gccatttcagatctcctgttcataagcacgcttcccttcagggctgactattatcttaga
ggctccaattggatatttggagacctggcctgcaggattatgtcttattccttgtatgtc
aacatgtacagcagtatttatttcctgaccgtgctgagtgttgtgcgtttcctggcaacg
gttcacccctttcggcttctgcatgtcaccagcatcaggagtgcctggatcctctgtggg
atcatatggatccttatcatggcttcctcaataatgctcctggacagtggctctgagcag
aacggcagtgtcacatcatgcttagagctgaatctctataaaattgctaagctgcagacc
atgaactatattgccttggtggtgggctgcctgctgccatttttcacactcagcatctgt
tatctgctgatcattcgggttctgttaaaagtggaggtcccagaatcggggctgcgggtt
tctcacaggaaggcactgaccaccatcatcatcaccttgatcatcttcttcttgtgtttc
ctgccctatcacacactgaggaccatccacttggcgacatggaaagtgggtatatgcaaa
gacagactgcataaagctgtggttatcacactggccttggcggcagccaatacctgcttc
aatcctctgctctattactttgctggggagaattttaaggacagactaaggtctgcactc
agaaaaggccatccacagaaggcaaagacaaagtgtgttttccctgttagtgtgtggttg
agaaaggaaacaagagtataa

KEGG   Pan paniscus (bonobo): 100977222
Entry
100977222         CDS       T02283                                 

Gene name
OXTR
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100977222 (OXTR)
   04024 cAMP signaling pathway
    100977222 (OXTR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100977222 (OXTR)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100977222 (OXTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100977222 (OXTR)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Oxytocin
    100977222 (OXTR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv Gaa1
Other DBs
NCBI-GeneID: 100977222
NCBI-ProteinID: XP_008965140
Position
3
AA seq 479 aa
MVLTALGRAAKAHEGLGDMSGARELGNVCGSSVHMGKRTRAIVQPQPQRTAPHPDAVRAR
SLGGAPRSPPVPIQRPARLRRGDSNRGSSERPQLSITLGAAGRPSQLGPGAHASLRPSVA
VQLPRGESTLGSPADSVQWKPLNIPRNWHAGGSGLVAGRGFPLICSGSEEGGLSRSVRGV
SRSGAPGAPTPSDTPDPAQPRQAVKGSKAGAHRCRQGHGGRARSQLERRGICQPLRSLRR
RTDRLAVLATWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYITWITLAVYI
VPVIVLAACYGLISFKIWQNLRLKTAAAAAAEAPEGAAAGDGGRVALARVSSVKLISKAK
IRTVKMTFIIVLAFIVCWTPFFFVQMWSVWDANAPKEASAFIIVMLLASLNSCCNPWIYM
LFTGHLFHELVQRFLCCSASYLRGKRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggtgctgactgccctggggagggcagctaaagcccacgaaggcctgggtgacatgtca
ggagcaagggagctgggcaatgtctgtggcagctctgtgcatatgggcaagcggacccgt
gcgatagtgcagcctcagccccagcgcacagcgccgcatccagacgctgtccgcgcgcgc
agcctgggaggcgctcctcgctcgcctcctgtacccatccagcgaccagccaggctgcgg
cgaggggattccaaccgaggctccagtgagagacctcagcttagcatcacattaggtgca
gccggcaggccatcccaactcgggccgggagcgcacgcgtcactgaggccgtcagtcgcc
gtgcaacttccccggggggagtcaactttaggttcacctgcggactcggtgcagtggaag
ccgctgaacatcccaaggaactggcacgctgggggctctgggcttgtggctggtagagga
ttcccgctcatttgcagtggctcagaggagggtggactcagcagatccgtccgtggagtc
tccaggagtggagccccaggcgcccctacaccctccgacacgccggatccggcccagccg
cgccaagccgtaaagggctcgaaggccggggcgcaccgctgccgccagggtcatggaggg
cgcgctcgcagccaactggagcgccgaggcatctgccagccgctgcgctcgctgcgccgc
cgcaccgaccgcctggcagtgctcgccacgtggctcggctgcctggtggccagcgcgccg
caggtgcacatcttctctctgcgcgaggtggctgacggcgtcttcgactgctgggccgtc
ttcatccagccctggggacccaaggcctacatcacgtggatcacgctagctgtctacatc
gtgccggtcatcgtgctcgctgcctgctacggccttatcagcttcaagatctggcagaac
ttgaggctcaagaccgctgcagcggcggcggccgaggcgccagagggcgcggcggctggc
gatggggggcgcgtggccctggcgcgtgtcagcagcgtcaagctcatctccaaggccaag
atccgcacggtcaagatgactttcatcatcgtgctggccttcatcgtgtgctggacgcct
ttcttcttcgtgcagatgtggagcgtctgggatgccaacgcgcccaaggaagcctcggcc
ttcatcatcgtcatgctcctggccagcctcaacagctgctgcaacccctggatctacatg
ctgttcacgggccacctcttccacgaactcgtgcagcgcttcctgtgctgctccgccagc
tacctgaggggcaaacgcctgggagagacgagtgccagcaaaaagagcaactcgtcctcc
tttgtcctgagccatcgcagctccagccagaggagctgctcccagccatccacggcgtga

KEGG   Pan paniscus (bonobo): 100977391
Entry
100977391         CDS       T02283                                 

Gene name
PTGFR
Definition
(RefSeq) prostaglandin F receptor
  KO
K04262  prostaglandin F receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04072  Phospholipase D signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100977391 (PTGFR)
   04072 Phospholipase D signaling pathway
    100977391 (PTGFR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100977391 (PTGFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100977391 (PTGFR)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    100977391 (PTGFR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv Serpentine_r_xa C_GCAxxG_C_C
Other DBs
NCBI-GeneID: 100977391
NCBI-ProteinID: XP_003807822
UniProt: A0A2R9B3G5
Position
1
AA seq 359 aa
MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQ
KSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGL
CPLLLGSVMAIERCIGVTKPIFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQ
ASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQG
RSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSLETCETTLFALRMATWNQILD
PWVYILLRKAVLKNLYKLASRCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtccatgaacaattccaaacagctagtgtctcctgcggctgcgcttctttcaaacaca
acctgccagacggaaaaccggctttccgtatttttttcagtaatcttcatgacagtggga
atcttgtcaaacagccttgccatcgccattctcatgaaggcatatcagagatttagacag
aagtccaaggcatcgtttctgcttttggccagtggcctggtaatcactgatttctttggc
catctcatcaatggagccatagcagtatttgtatatgcttctgataaagaatggatccgc
tttgaccaatcaaatgtcctttgcagtatttttggtatctgcatggtgttttctggtctg
tgcccacttcttctaggcagtgtgatggccattgagcggtgtattggagtcacaaaacca
atatttcattctacgaaaattacatccaaacatgtgaaaatgatgttaagtggtgtgtgc
ttgtttgctgttttcatagctttgctgcccatccttggacatcgagactataaaattcag
gcgtcgaggacctggtgtttctacaacacagaagacatcaaagactgggaagatagattt
tatcttctacttttttcttttctggggctcttagcccttggtgtttcattgttgtgcaat
gcaatcacaggaattacacttttaagagttaaatttaaaagtcagcagcacagacaaggc
agatctcatcatttggaaatggtaatccagctcctggcgataatgtgtgtctcctgtatt
tgttggagcccatttctggttacaatggccaacattggaataaatggaaatcattctctg
gaaacctgtgaaacaacactttttgctctccgaatggcaacatggaatcaaatcttagat
ccttgggtatatattcttctacggaaggctgtccttaagaatctctataagcttgccagt
cgatgctgtggagtgcatgtcatcagcttacatatttgggagcttagttccattaaaaat
tccttaaaggttgctgctatttctgagtcaccagttgcagagaaatcagcaagcacctag

KEGG   Pan paniscus (bonobo): 100978396
Entry
100978396         CDS       T02283                                 

Gene name
ADRA1D
Definition
(RefSeq) adrenoceptor alpha 1D
  KO
K04137  adrenergic receptor alpha-1D
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100978396 (ADRA1D)
   04022 cGMP-PKG signaling pathway
    100978396 (ADRA1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100978396 (ADRA1D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100978396 (ADRA1D)
   04270 Vascular smooth muscle contraction
    100978396 (ADRA1D)
  09154 Digestive system
   04970 Salivary secretion
    100978396 (ADRA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100978396 (ADRA1D)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    100978396 (ADRA1D)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv DUF1180
Other DBs
NCBI-GeneID: 100978396
NCBI-ProteinID: XP_008973081
Position
20
AA seq 734 aa
MGSPSPPRHFCKQAFISLSADPRRLLLSGGQSRDPEDPGLTPSTHRAPKGTSESPRDSGE
RAGGRGTALRAKGEGVRERSGKERKGHREGRARAWAPAERRGWLLWDPSARQRRSPPDPD
TIACPERRVPSPLERGAPLSARVAPSSFLALPLLGPAPRAELGAPQWPLPAPPGPGAAAL
PACRARSERRARSGPRLFGATPRPASGSPAAAGPGSSALGQPRSASQELGSGEDNRSSAG
EPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILSVACNRHLQTV
TNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCCTASILSLCTI
SVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVPPDERFCGITE
EAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKASEVVLRIHCRG
AATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFFVLPL
GSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRRRRRRRPL
WRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEMQAPVASRRKP
PSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEVEAVSLGVPHEVAEGATCQA
YELADYSNLRETDI
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgggttctccgtcccctcccagacacttctgcaaacaggccttcatctccctgtccgca
gatcccaggcgcttgctgctctctggcggccaaagccgggatcccgaagacccgggactc
acgccttcaacgcaccgcgcgcccaagggcaccagcgagtcaccaagagactcgggggag
agggcgggaggaagagggacggcgctgagggccaagggggagggggtccgggagaggagc
gggaaggaacgcaaagggcaccgcgaggggagagcgcgggcttgggcacctgcggagagg
cgtgggtggctgctgtgggacccgagcgcgcgccagcgccgcagccccccggaccccgac
acaatcgcctgtcccgagcgaagggtcccttctcccctggagcgtggcgcccctctctcg
gcccgggtcgccccctcctccttcctggcgctgcccctcctcggtcccgccccccgcgcc
gagttgggagcgccgcagtggccgctgcctgcaccgcccggccccggagccgccgctttg
cccgcttgccgggcacgctcagagcgccgcgcgcgtagcgggccccggctcttcggtgct
actccacggccggcctcggggagcccggccgccgccgggccaggcagctccgctctcgga
cagccgcgctccgcgtcacaggaacttggcagcggcgaggacaaccggagctccgcgggg
gagccggggagcgcgggcgcgggcggcgacgtgaatggcacggcggccgtcgggggactg
gtggtgagcgcgcagggcgtgggcgtgggcgtcttcctggcagccttcatccttatggcc
gtggcaggtaacctgcttgtcatcctctcagtggcctgcaaccgccacctgcagaccgtc
accaactatttcatcgtgaacctggccgtggccgacctgctgctgagcgccaccgtactg
cccttctcggccaccatggaggttctgggcttctgggcctttggccgggccttctgcgac
gtatgggccgccgtggacgtgctgtgctgcacggcctccatcctcagcctctgcaccatc
tccgtggaccggtacgtgggcgtgcgccactcactcaagtacccagccatcatgaccgag
cgcaaggcggccgccatcctggcgctgctgtgggtcgtagccctggtggtgtccgtaggg
cccctgctgggctggaaggagcccgtgccccctgacgagcgcttctgcggtatcaccgag
gaggcgggctacgctgtcttctcctccgtgtgctccttctacctgcccatggcggtcatc
gtggtcatgtactgccgcgtgtacgtggtcgcgcgcagcaccacgcgcagcctcgaggcg
ggcgtcaagcgcgagcgaggcaaggcctccgaggtggtgctgcgcatccactgtcgcggc
gcggccacgggcgccgacggggcgcacggcatgcgcagcgccaagggccacaccttccgc
agctcgctctccgtgcgcctgctcaagttctcccgtgagaagaaagcggccaagactctg
gccatcgtcgtgggtgtcttcgtgctctgctggttccctttcttctttgtcctgccgctc
ggctccttgttcccgcagctgaagccatcggagggcgtcttcaaggtcatcttctggctc
ggctacttcaacagctgcgtgaacccgctcatctacccctgttccagccgcgagttcaag
cgcgccttcctccgtctcctgcgctgccagtgccgtcgtcgccggcgccgccgccctctc
tggcgtgtctacggccaccactggcgggcctccaccagcggcctgcgccaggactgcgcc
ccgagttcgggcgacgcgccccccggagcgccgctggccctcaccgcgctccccgacccc
gaccccgaacccccaggcacgcccgagatgcaggctccggtcgccagccgtcgaaagcca
cccagcgccttccgcgagtggaggctgctggggccgttccggagacccacgacccagctg
cgcgccaaagtctccagcctgtcgcacaagatccgcgccgggggcgcgcagcgcgcagag
gtggaggctgtgtccctaggcgtcccacacgaggtggccgagggcgccacctgccaggcc
tacgaattggccgactacagcaacctacgggagaccgatatttaa

KEGG   Pan paniscus (bonobo): 100979999
Entry
100979999         CDS       T02283                                 

Gene name
HRH1
Definition
(RefSeq) histamine receptor H1
  KO
K04149  histamine receptor H1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100979999 (HRH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100979999 (HRH1)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100979999 (HRH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100979999 (HRH1)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    100979999 (HRH1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF1601
Other DBs
NCBI-GeneID: 100979999
NCBI-ProteinID: XP_008949971
UniProt: A0A2R8ZS93
Position
3
AA seq 487 aa
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINGSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
HCFPLDIVHMQTAAEGSSRDYVAVNQSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgagcctccccaattcctcctgcctcttagaagacaagatgtgtgagggcaacaagacc
actatggccagcccccagctgatgcccctggtggtggtcctgagcactatctgcttggtc
acagtagggctcaacctgctggtgctgtatgctgtacggagtgagcggaagctccacact
gtggggaacctgtacatcgtcagcctctcggtggcggacctgatcgtgggtgccgtcgtc
atgcctatgaacatcctctacctgctcatgtccaagtggtcactgggccgtcctctctgc
ctcttttggctttccatggactatgtggccagcacagcgtccattttcagtgtcttcatc
ctgtgcattgatcgctaccgctctgtccagcagcccctcaggtaccttaagtatcgtacc
aagacccgagcctcggccaccattttgggggcctggtttctctcttttctgtgggttatt
cccattctaggctggaatcacttcatgcagcagacctcggtgcgccgagaggacaagtgt
gagacagacttctatgatgtcacctggttcaaggtcatgactgccatcatcaacttctac
ctgcccaccttgctcatgctctggttctatgccaagatctacaaggccgtacgacaacac
tgccagcaccgcgagctcatcaatgggtccctcccttccttctcagaaattaagctgagg
ccagagaaccccaagggggatgccaagaaaccagggaaggagtctccctgggaggttctg
aaaaggaagccaaaagatgctggtggtggatctgtcttgaagtcaccatcccaaaccccc
aaggagatgaaatccccagttgtcttcagccaagaggatgatagagaagtagacaaactc
cactgctttccacttgatattgtgcacatgcagactgcggcagaggggagtagcagggac
tatgtagccgtcaaccagagccatggccagctcaagacagatgagcagggcctgaacaca
catggggccagcgagatatcagaggatcagatgttaggtgatagccaatccttctctcga
acagactcagataccaccacagagacagcaccaggcaaaggcaaattgaggagtgggtct
aacacaggcctggattacatcaagtttacttggaagaggctccgctcgcattcaagacag
tatgtatctgggttgcacatgaaccgcgaaaggaaggccgccaaacagttgggttttatc
atggcagccttcatcctctgctggatcccttatttcatcttcttcatggtcattgccttc
tgcaagaattgttgcaatgaacatttgcacatgttcaccatctggctgggctacatcaac
tccacactgaaccccctcatctaccccttgtgcaatgagaacttcaagaagacattcaag
agaattctgcatattcgctcctaa

KEGG   Pan paniscus (bonobo): 100980919
Entry
100980919         CDS       T02283                                 

Gene name
LTB4R2
Definition
(RefSeq) leukotriene B4 receptor 2
  KO
K04297  leukotriene B4 receptor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100980919 (LTB4R2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100980919 (LTB4R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100980919 (LTB4R2)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Lipid
   Leukotriene
    100980919 (LTB4R2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100980919
NCBI-ProteinID: XP_008959514
Position
14
AA seq 385 aa
MRTFHKQELTRASPGPQSCLLPAWPRRMSVCYRPPGNETLLSWKTSRATGTAFLLLAALL
GLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTGQAWPLGQAG
CKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAALLLA
VPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLRGARW
GSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAARAGT
TALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRTTPQL
KVVGQGRGNGDPGGGMEKDGPEWDL
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaggactttccacaagcaagagctaactagggcttctccaggcccccaatcctgcttg
ctcccagcttggcccagaaggatgtcggtctgctaccgtcccccagggaacgagacactg
ctgagctggaagacttcgcgggccacaggcacagccttcctgctgctggcggcgctgctg
gggctgcccggcaacggcttcgtggtgtggagcttggcgggctggcggcctgcacggggg
cgaccgctggcggccacgcttgtgctgcacctggcgctggccgacggcgcggtgctgctg
ctcacgccgctctttgtggccttcctgaccgggcaggcctggccgctgggccaggcgggc
tgcaaggcggtgtactacgtgtgcgcgctcagcatgtacgccagcgtgctgctcaccggc
ctgctcagcctgcagcgctgcctcgcagtcacccgccccttcctggcgcctcggctgcgc
agcccggccctggcccgccgcctgctgctggccgtctggctggccgccctgttgctcgcc
gtcccggccgccgtctaccgccacctgtggagggaccgcgtatgccagctgtgccacccg
tcgccggtccacgccgccgcccacctgagcctggagactctgaccgccttcgtgcttcct
ttcgggctgatgctcggctgctacagcgtgacgctggcacggctgcggggcgcccgctgg
ggctccgggcggcacggggcgcgggtgggccggctggtgagcgccatcgtgcttgccttc
ggcttgctctgggccccctaccacgcagtcaaccttctgcaggcggtcgcagcgctggct
ccaccggaaggggccttggcgaagctgggcggagccggccaggcggcgcgagcgggaact
acggccttggccttcttcagttctagcgtcaacccggtgctctacgtcttcaccgctgga
gatctgctgccccgggcaggtccccgtttcctcacgcggctcttcgaaggctctggggag
gcccgagggggcggccgctctagggaggggaccatggagctccgaactacccctcagctg
aaagtggtggggcagggccgcggcaatggagacccggggggtgggatggagaaggacggt
ccggaatgggacctttga

KEGG   Pan paniscus (bonobo): 100982037
Entry
100982037         CDS       T02283                                 

Gene name
TACR1
Definition
(RefSeq) tachykinin receptor 1
  KO
K04222  tachykinin receptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100982037 (TACR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100982037 (TACR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100982037 (TACR1)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Tachykinin
    100982037 (TACR1)
SSDB
Motif
Pfam: 7tm_1 TctB 7tm_4
Other DBs
NCBI-GeneID: 100982037
NCBI-ProteinID: XP_003810366
UniProt: A0A2R8ZV24
Position
2A
AA seq 407 aa
MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggataacgtcctcccggtggactcagacctctccccaaacatctccactaacacctcg
gaacccaatcagttcgtgcaaccagcctggcaaattgtcctttgggcagctgcctacacg
gtcattgtggtgacctctgtggtgggcaacgtggtagtgatgtggatcatcttagcccac
aaaagaatgaggacagtgaccaactattttctggtgaacctggccttcgcggaggcctcc
atggctgcattcaatacagtggtgaacttcacctatgctgtccacaacgaatggtactac
ggcctgttctactgcaagttccacaacttcttccccatcgccgctgtcttcgccagtatc
tactccatgacggctgtggcctttgataggtacatggccatcatacatcccctccagccc
cggctgtcagccacagccaccaaagtggtcatctgtgtcatctgggtcctggctctcctg
ctggccttcccccagggctactactcaaccacagagaccatgcccagcagagtcgtgtgc
atgatcgaatggccagagcatccgaacaagatttatgagaaagtgtaccacatctgtgtg
actgtgctgatctacttcctccccctgctggtgattggctatgcatacaccgtagtggga
atcacactatgggccagtgagatccccggggactcctctgaccgctaccacgagcaagtc
tctgccaagcgcaaggtggtcaaaatgatgattgtcgtggtgtgcaccttcgccatctgc
tggctgcccttccacatcttcttccttctgccctacatcaacccagatctctacctgaag
aagtttatccagcaggtctacctggccatcatgtggctggccatgagctccactatgtac
aaccccatcatctactgctgcctcaatgacaggttccgtctgggcttcaagcatgccttc
cggtgctgccccttcatcagcgccggcgactatgaggggctggaaatgaaatctacccgg
tatctccagacccagggcagtgtgtacaaagtcagccgcctggagaccaccatctccaca
gtggtgggggcccacgaggaggagccagaggacggccccaaggccacaccctcgtccctg
gacctgacctccaactgctcttcacgaagtgactccaagaccatgacagagagcttcagc
ttctcctccaatgtgctctcctag

KEGG   Pan paniscus (bonobo): 100983802
Entry
100983802         CDS       T02283                                 

Gene name
GRPR
Definition
(RefSeq) gastrin releasing peptide receptor
  KO
K04169  gastrin-releasing peptide receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100983802 (GRPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100983802 (GRPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100983802 (GRPR)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Bombesin
    100983802 (GRPR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 100983802
NCBI-ProteinID: XP_003805404
UniProt: A0A2R9B7E7
Position
X
AA seq 384 aa
MALNDCFLLNLEVDHFMHCNISNHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNIT
LIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ
LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSD
LHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS
AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH
FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS
LKSTNPSVATFSLINGNICHERYV
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggctctaaatgactgtttccttctgaacttggaggtggaccatttcatgcactgcaac
atctccaatcacagtgcggatctccccgtgaacgacgactggtcccacccggggatcctc
tatgtcatccctgcagtttatggggttatcattctgataggcctcattggcaacatcact
ttgatcaagatcttctgtacagtcaagtccatgcgaaacgttccaaacctgttcatttcc
agtctggctttgggagacctgctcctcctaataacgtgtgctccagtggatgccagcagg
tacctggctgacagatggctatttggcaggattggctgcaaactgatcccctttatacag
cttacctctgttggggtgtctgtcttcacactcacggcgctctcggcagacagatacaaa
gccattgtccggccaatggatatccaggcctctcatgccctaatgaagatctgcctcaaa
gccgcctttatctggatcatctccatgctgctggccattccagaggccgtgttttctgac
ctccatcccttccatgaggaaagcaccaaccagaccttcattagctgtgccccataccca
cactctaatgagcttcaccccaaaatccattctatggcttcctttctggtcttctacgtc
atcccactgtcgatcatctctgtttactactacttcattgctaaaaatctgatccagagt
gcttacaatcttcccgtggaagggaatatacatgtcaagaagcagattgaatcccggaag
cgacttgccaagacagtgctggtgtttgtgggcctgttcgccttctgctggctccccaat
cacgtcatctacctgtaccgctcctaccactactctgaggtggacacctccatgctccac
tttgtcaccagcatctgtgcccgcctcctggccttcaccaactcctgcgtgaaccccttt
gccctctacctgctgagcaagagtttcaggaaacagttcaacactcagctcctctgttgc
cagcctggcctgatcatccggtctcacagcactggaaggagtacaacctgcatgacctcc
ctcaagagtaccaacccctccgtggccacctttagcctcatcaatggaaacatctgtcac
gagcggtatgtctag

KEGG   Pan paniscus (bonobo): 100983956
Entry
100983956         CDS       T02283                                 

Gene name
TACR3
Definition
(RefSeq) tachykinin receptor 3
  KO
K04224  tachykinin receptor 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100983956 (TACR3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100983956 (TACR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100983956 (TACR3)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Tachykinin
    100983956 (TACR3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 100983956
NCBI-ProteinID: XP_003830014
UniProt: A0A2R9AIG6
Position
4
AA seq 465 aa
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL
PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT
NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA
VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG
PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN
KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPTRQSSMYTVTRMESMTVVFDPNDADT
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggccactctcccagcagcagaaacctggatagacgggggtggaggcgtgggtgcagac
gccgtgaacctgaccgcctcgctagctgccggggcggccacgggggcagttgagactggg
tggctgcaactgctggaccaagctggcaacctctcctcctccccctccgcgctgggactg
cctgtggcttcccccgcgccctcccagccctgggccaacctcaccaaccagttcgtgcag
ccgtcctggcgcatcgcgctctggtccctggcgtatggtgtggtggtggcagtggcagtt
ttgggaaatctcatcgtcatctggatcatcctggcccacaagcgcatgaggactgtcacc
aactacttccttgtgaacctagctttctccgacgcctccatggccgccttcaacacgttg
gtcaatttcatctacgcgcttcatagcgagtggtactttggcgccaactactgccgcttc
cagaatttctttcctatcacagctgtgttcgccagcatctactccatgacggccattgcg
gtggacaggtatatggctattattgatcccttgaaacccagactgtctgctacagcaacc
aagattgtcattggaagtatttggattctagcatttctacttgccttccctcagtgtctt
tattccaaaaccaaagtcatgccaggccgtactctctgctttgtgcaatggccagaaggt
cccaaacaacatttcacttatcatattatcgtcattatactggtgtactgtttcccattg
ctcatcatgggtattacatacaccattgttggaattactctctggggaggagaaatccca
ggagatacctgtgacaagtatcatgagcagctaaaggccaaaagaaaggttgtcaaaatg
atgattattgttgtcatgacatttgctatctgctggctgccctatcatatttacttcatt
ctcactgcaatctatcaacaactaaatagatggaaatacatccagcaggtctacctggct
agcttttggctggcaatgagctcaaccatgtacaatcccatcatctactgctgtctgaat
aaaagatttcgagctggcttcaagagagcatttcgctggtgtcctttcatcaaagtttcc
agctatgatgagctagagctcaagaccaccaggtttcatccaacccggcaaagcagtatg
tacaccgtgaccagaatggagtccatgacagtcgtgtttgaccccaacgatgcagacacc
accaggtccagtcggaagaaaagagcaacgccaagagacccaagtttcaatggctgctct
cgcaggaattccaaatctgcctccgccacttcaagtttcataagctcaccctatacctct
gtggatgaatattcttaa

KEGG   Pan paniscus (bonobo): 100984964
Entry
100984964         CDS       T02283                                 

Gene name
PTAFR
Definition
(RefSeq) platelet activating factor receptor
  KO
K04279  platelet-activating factor receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100984964 (PTAFR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100984964 (PTAFR)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100984964 (PTAFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100984964 (PTAFR)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Others
   Platelet activating factor
    100984964 (PTAFR)
SSDB
Motif
Pfam: 7tm_1 SHNi-TPR SK_channel
Other DBs
NCBI-GeneID: 100984964
NCBI-ProteinID: XP_003828130
UniProt: A0A2R8ZQA4
Position
1
AA seq 342 aa
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPSKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPNGAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggagccacatgactcctcccacatggactctgagttccgatacactctcttcccgatt
gtttacagcatcatctttgtgcttggggtcattgctaatggctacgtgctgtgggtcttt
gcccgcctgtacccttccaagaaattcaatgagataaagatcttcatggtgaacctcacc
atggcggacatgctcttcttgatcaccctgccactgtggattgtctactaccaaaaccag
ggcaactggatactccccaaattcctgtgcaacgtggctggctgccttttcttcatcaac
acctactgctctgtggccttcctgggcgtcatcacttataaccgcttccaggcagtaact
cggcccatcaagactgctcaggccaacacccgcaagcgtggcatctctttgtccttggtc
atctgggtggccattgtgggagctgcatcctacttcctcatcctggactccaccaacaca
gtgcccaacggtgctggctcaggcaacgtcactcgctgctttgagcattacgagaagggc
agcgtgccagtcctcatcatccacatcttcatcgtgttcagcttcttcctggtcttcctc
atcatcctcttctgcaacctggtcatcatccgtaccttgctcatgcagccggtgcagcag
cagcgcaacgctgaagtcaagcgccgggcgctgtggatggtgtgcacggtcttggcggtg
ttcatcatctgcttcgtgccccaccacgtggtgcagctgccctggacccttgctgagctg
ggcttccaggacagcaaattccaccaggccattaatgatgcacatcaggtcaccctctgc
ctccttagcaccaactgtgtcttagaccctgttatctactgtttcctcaccaagaagttc
cgcaagcacctcaccgaaaagttctacagcatgcgcagtagccggaaatgctcccgggcc
accacggatacggtcactgaagtggttgtgccattcaaccagatccctggcaattccctc
aaaaattag

KEGG   Pan paniscus (bonobo): 100985583
Entry
100985583         CDS       T02283                                 

Gene name
HTR2B
Definition
(RefSeq) 5-hydroxytryptamine receptor 2B
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04540  Gap junction
pps04726  Serotonergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100985583 (HTR2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100985583 (HTR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100985583 (HTR2B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100985583 (HTR2B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100985583 (HTR2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100985583 (HTR2B)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100985583 (HTR2B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4
Other DBs
NCBI-GeneID: 100985583
NCBI-ProteinID: XP_003821908
UniProt: A0A2R8ZJ48
Position
2B
AA seq 481 aa
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGNFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKVLPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggctctctcttacagagtgtctgaacttcaaagcacaattcctgagcacattttgcag
agcacctttgttcacgttatctcttctaactggtctggattacagacagaatcaatacca
gaggaaatgaaacagattgttgaggaacagggaaataaactgcactgggcagctcttctg
atactcatggtgataatacccacaattggtggaaatacccttgttattctggctgtttcg
ctggagaaaaagctgcagtatgctactaattactttctaatgtccttggcggtggctgat
ttgctggttggattgtttgtgatgccaattgccctcttgacaataatgtttgaggctatg
tggcccctcccacttgttctatgtcctgcctggttatttcttgacgttctcttttcaact
gcatccatcatgcatctctgtgccatttcagtggatcgttacatagccatcaaaaagcca
atccaggccaatcaatataactcacgggctacagcattcatcaagattacagtggtgtgg
ttaatttcaataggcattgccattccagtccctattaaagggatagagactgatgtggac
aacccaaacaatatcacttgtgtgctgacaaaggaacgttttggcaatttcatgctcttt
ggctcactggctgccttcttcacacctcttgcaattatgattgtcacctactttctcact
atccacgctttacagaagaaagcttacttagtcaaaaacaagccacctcaacgcctaaca
tggttgactgtgtctacagttttccaaagggatgaaacaccttgctcgtcaccggaaaag
gtggcaatgctggatggttctcgaaaggacaaggttctgcccaactcaggtgatgaaaca
cttatgcgaagaacatccacaattgggaaaaagtcagtgcagaccatttccaatgaacag
agagcctcaaaggtcctagggattgtgtttttcctctttttgcttatgtggtgtcccttc
tttattacaaatataactttagttttatgtgattcctgtaaccaaactactctccaaatg
ctcctggagatatttgtgtggataggctatgtttcctcaggagtgaatcctttggtctac
accctcttcaataagacatttcgggatgcatttggccgatatatcacctgcaattaccgg
gccacaaagtcagtaaaaactctcagaaaacgctccagtaagatctacttccggaatcca
atggcagagaactctaagtttttcaagaaacatggaattcgaaatgggattaatcctgcc
atgtaccagagtccaatgaggctccgaagttcaaccattcagtcttcatcaatcattcta
ctagatacacttctcctcactgaaaatgaaggtgacaaaactgaagagcaagttagttat
gtatag

KEGG   Pan paniscus (bonobo): 100986369
Entry
100986369         CDS       T02283                                 

Gene name
F2R
Definition
(RefSeq) coagulation factor II thrombin receptor
  KO
K03914  coagulation factor II (thrombin) receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04072  Phospholipase D signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04151  PI3K-Akt signaling pathway
pps04610  Complement and coagulation cascades
pps04611  Platelet activation
pps04810  Regulation of actin cytoskeleton
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100986369 (F2R)
   04020 Calcium signaling pathway
    100986369 (F2R)
   04072 Phospholipase D signaling pathway
    100986369 (F2R)
   04024 cAMP signaling pathway
    100986369 (F2R)
   04151 PI3K-Akt signaling pathway
    100986369 (F2R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100986369 (F2R)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100986369 (F2R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100986369 (F2R)
   04611 Platelet activation
    100986369 (F2R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100986369 (F2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100986369 (F2R)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Thrombin
    100986369 (F2R)
SSDB
Motif
Pfam: 7tm_1 DUF4064
Other DBs
NCBI-GeneID: 100986369
NCBI-ProteinID: XP_003808427
UniProt: A0A2R9B5R1
Position
5
AA seq 425 aa
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSVNKSSPLQKPLPAFISEDASGYLTSSWLTVFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggggccgcggcggctgctgctggtggccgcctgcttcagtctgtgcggcccgctgttg
tctgcccgcacccgggcccgcaggccagaatcaaaagcaacaaatgccaccttagatccc
cggtcatttcttctcaggaaccccaatgataaatatgaaccattttgggaggatgaggag
aaaaatgaaagtgggttaactgaatacagattagtctccgtcaataaaagcagtcctctt
caaaaaccacttcctgcattcatctcagaagatgcctccggatatttgaccagctcctgg
ctgacagtctttgtcccatctgtgtacaccggagtgtttgtagtcagcctcccactaaac
atcatggccatcgttgtgttcatcctgaaaatgaaggtcaagaagccggcggtggtgtac
atgctgcacctggccacggcagatgtgctgtttgtgtctgtgctcccctttaagatcagc
tattacttttccggcagtgattggcagtttgggtctgaattgtgtcgcttcgtcactgca
gcgttttactgtaacatgtacgcctctatcttgctcatgacagtcataagcattgaccgg
tttctggctgtggtgtatcccatgcagtccctctcctggcgtactctgggaagggcttcc
ttcacttgtctggccatctgggctttggccatcgcaggggtagtgcctctgctcctcaag
gagcaaaccatccaggtgcccgggctcaacatcactacctgtcatgatgtgctcaatgaa
accctgctcgaaggctactatgcctactacttctcagccttctctgctgtcttctttttt
gtgccgctgatcatttccacggtctgttatgtgtctatcattcgatgtcttagctcttcc
gcagttgccaaccgcagcaagaagtcccgggctttgttcctgtcagctgctgttttctgc
atcttcatcatttgcttcggacccacaaacgtcctcctgattgcgcattactcattcctt
tctcacacttccaccacagaggctgcctactttgcctacctcctctgtgtctgtgtcagc
agcataagctgctgcatcgaccccctaatttactattacgcttcctctgagtgccagagg
tacgtctacagtatcttatgctgcaaagaaagttccgatcccagcagttataacagcagt
gggcagttgatggcaagtaaaatggatacctgctctagtaacctgaataacagcatatac
aaaaagctgttaacttag

KEGG   Pan paniscus (bonobo): 100986370
Entry
100986370         CDS       T02283                                 

Gene name
EDNRB
Definition
(RefSeq) endothelin receptor type B
  KO
K04198  endothelin receptor type B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04916  Melanogenesis
pps04926  Relaxin signaling pathway
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100986370 (EDNRB)
   04022 cGMP-PKG signaling pathway
    100986370 (EDNRB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100986370 (EDNRB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100986370 (EDNRB)
   04916 Melanogenesis
    100986370 (EDNRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100986370 (EDNRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100986370 (EDNRB)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Endothelin
    100986370 (EDNRB)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 100986370
NCBI-ProteinID: XP_003825301
UniProt: A0A2R8ZUY0
Position
13
AA seq 532 aa
MNKSTCLMAAETPSKRWRLHCLAFSQRFVRARPACSSREACSSPRAGWNPAGFRVPGRWS
PFVALHLVCQIREALKLRSGHRTPSGTGSSMQPPPSLCGRALVALVLACGLSRIWGEERG
FPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPC
QGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLH
IVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIK
GIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYK
TAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVL
VFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVS
KRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgaataaaagtacttgtctgatggcagcagagaccccgagcaaacggtggaggctacac
tgtctggcattctcgcagcgtttcgtcagagccagacccgcctgcagctcaagggaggcg
tgctcctctcccagagcaggctggaacccagctgggttccgcgtcccgggaaggtggtct
ccattcgtcgctctgcatctggtttgtcagatccgagaggctctgaaactgcggagcggc
caccggacgccttctggaacaggtagcagcatgcagccgcctccaagtctgtgcggacgc
gccctggttgcgctggttcttgcctgcggcctgtcgcggatctggggagaggagagaggc
ttcccgcctgacagggccactccgcttttgcaaaccgcagagataatgacgccacccact
aagaccttatggcccaagggttccaacgccagtctggcgcggtcgttggcacctgcggag
gtgcctaaaggagacaggacggcaggatctccgccacgcaccatctcccctcccccgtgc
caaggacccatcgagatcaaggagactttcaaatacatcaacacggttgtgtcctgcctt
gtgttcgtgctggggatcatcgggaactccacacttctgagaattatctacaagaacaag
tgcatgcgaaacggtcccaatatcttgatcgccagcttggctctgggagacctgctgcac
atcgtcattgacatccctatcaatgtctacaagctgctggcagaggactggccatttgga
gctgagatgtgtaagctggtgcctttcatacagaaagcctccgtgggaatcactgtgctg
agtctatgtgctctgagtattgacagatatcgagctgttgcatcttggagtagaattaaa
ggaattggggttccaaaatggacagcagtagaaattgttttgatttgggtggtctctgtg
gttctggctgtccctgaagccataggttttgatataattacgatggactacaaaggaagt
tatctacgaatctgcttgcttcatcccgttcagaagacagctttcatgcagttttacaag
acagcaaaagattggtggctattcagtttctatttctgcttgccattggccatcactgca
tttttttatacgctaatgacctgtgaaatgttgagaaagaaaagtggcatgcagattgct
ttaaatgatcacctaaagcagagacgggaagtggccaaaactgtcttttgcctggtcctt
gtctttgccctctgctggcttccccttcacctcagcaggattctgaagctcactctttat
aatcagaatgatcccaatagatgtgaacttttgagctttctgttggtattggactatatt
ggtatcaacatggcttcactgaattcctgcattaacccaattgctctgtatttggtgagc
aaaagattcaaaaactgctttaagtcatgcttatgctgctggtgccagtcatttgaagaa
aaacagtccttggaggaaaagcagtcgtgcttaaagttcaaagctaatgatcacggatat
gacaacttccgttccagtaataaatacagctcatcttga

KEGG   Pan paniscus (bonobo): 100986689
Entry
100986689         CDS       T02283                                 

Gene name
HTR2C
Definition
(RefSeq) 5-hydroxytryptamine receptor 2C
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04540  Gap junction
pps04726  Serotonergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100986689 (HTR2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100986689 (HTR2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100986689 (HTR2C)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100986689 (HTR2C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100986689 (HTR2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100986689 (HTR2C)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100986689 (HTR2C)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv Pox_P21 DUF1385 7TM_GPCR_Srx 7tm_4 UPF0182 DUF2208
Other DBs
NCBI-GeneID: 100986689
NCBI-ProteinID: XP_008969375
Position
X
AA seq 316 aa
MHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFV
NNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLD
FLKCCRRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLI
MWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNY
LRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLE
LPVNPSSVVSERISSV
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcacctctgcgctatatcgctggatcggtatgtagcaatacgtaatcctattgagcat
agccgtttcaattcgcggactaaggccatcatgaagattgctattgtttgggcaatttct
ataggtgtatcagttcctatccctgtgattggactgagggacgaagaaaaggtgttcgtg
aacaacacgacgtgcgtgctcaacgacccaaatttcgttcttattgggtccttcgtagct
ttcttcataccgctgacgattatggtgattacgtattgcctgaccatctacgttctgcgc
cgacaagctttgatgttactgcacggccacaccgaggaaccgcctggactaagtctggat
ttcctgaagtgctgcaggaggaatacggccgaggaagagaactctgcaaaccctaaccaa
gaccagaacgcacgccgaagaaagaagaaggagagacgtcctaggggcaccatgcaggct
atcaacaatgaaagaaaagcttcgaaagtccttgggattgttttctttgtgtttctgatc
atgtggtgcccatttttcattaccaatattctgtctgttctttgtgagaagtcctgtaac
caaaagctcatggaaaagcttctgaatgtgtttgtttggattggctatgtttgttcagga
atcaatcctctggtgtatactctgttcaacaaaatttaccgaagggcattctccaactat
ttgcgctgcaattataaggtagagaaaaagcctcctgtcaggcagattccaagagttgcc
gccactgctttgtctgggagggagcttaatgttaacatttatcggcataccaatgaaccg
gtgatcgagaaagccagtgacaatgagcccggtatagagatgcaagttgagaatttagag
ttaccagtaaatccctccagtgtggttagcgaaaggattagcagtgtgtga

KEGG   Pan paniscus (bonobo): 100986808
Entry
100986808         CDS       T02283                                 

Gene name
ADRA1A
Definition
(RefSeq) adrenoceptor alpha 1A
  KO
K04135  adrenergic receptor alpha-1A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04152  AMPK signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100986808 (ADRA1A)
   04022 cGMP-PKG signaling pathway
    100986808 (ADRA1A)
   04152 AMPK signaling pathway
    100986808 (ADRA1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100986808 (ADRA1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100986808 (ADRA1A)
   04270 Vascular smooth muscle contraction
    100986808 (ADRA1A)
  09154 Digestive system
   04970 Salivary secretion
    100986808 (ADRA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100986808 (ADRA1A)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    100986808 (ADRA1A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 100986808
NCBI-ProteinID: XP_003823597
UniProt: A0A2R9CSP8
Position
8
AA seq 429 aa
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARGHTPMT
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggtgtttctctccggaaatgcttccgacagctccaactgcacccaaccgccggcaccg
gtgaacatttccaaggccattctgctcggggtgatcttggggggcctcattcttttcggg
gtgctgggtaacatcctagtgatcctctccgtagcctgtcaccgacacctgcactcagtc
acgcactactacatcgtcaacctggcggtggccgacctcctgctcacctccacggtgctg
cccttttccgccatcttcgaggtcctaggctactgggccttcggcagggtcttctgcaac
atctgggcggcagtggatgtgctgtgctgcaccgcgtccatcatgggcctctgcatcatc
tccatcgaccgctacatcggcgtgagctacccgctgcgctacccaaccatcgtcacccag
aggaggggtctcatggctttgctctgcgtctgggcactctccctggtcatatccattgga
cccctgttcggctggaggcagccggcccccgaggacgagaccatctgccagatcaacgag
gagccgggctacgtgctcttctcagcgctgggctccttctacctgccgctggccatcatc
ctggtcatgtactgccgcgtctacgtggtggccaagagggagagccggggcctcaagtct
ggcctcaagaccgacaagtcggactcggagcaagtgacgctccgcatccatcggaaaaac
gccccggcaggaggcagcgggatggccagcgccaagaccaagacgcacttctcagtgagg
ctcctcaagttctcccgggagaagaaagcggccaaaacgctgggcatcgtggttggctgc
ttcgtcctctgctggctgcctttcttcttagtcatgcccattgggtctttcttccctgat
ttcaagccctctgaaacagtttttaaaatagtattttggctcggatatctaaacagctgc
atcaaccccatcatatacccatgctccagccaagagttcaaaaaggcctttcagaatgtc
ttgagaatccagtgtctccgcagaaagcagtcttccaaacatgccctgggctacaccctg
cacccgcccagccaggccgtggaagggcagcacaaggacatggtgcgcatccccgtggga
tcaagagagaccttctacaggatctccaagacggatggcgtttgtgaatggaaatttttc
tcttccatgccccgtggatctgccaggattacagtgtccaaagaccaatcctcctgtacc
acagcccggggacacacacccatgacatga

KEGG   Pan paniscus (bonobo): 100988035
Entry
100988035         CDS       T02283                                 

Gene name
TBXA2R
Definition
(RefSeq) thromboxane A2 receptor
  KO
K04264  thromboxane A2 receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100988035 (TBXA2R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100988035 (TBXA2R)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100988035 (TBXA2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100988035 (TBXA2R)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Lipid
   Thromboxane
    100988035 (TBXA2R)
SSDB
Motif
Pfam: 7tm_1 DUF3784
Other DBs
NCBI-GeneID: 100988035
NCBI-ProteinID: XP_003819304
Position
19
AA seq 407 aa
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRATEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLLTLWPSLEYSGMISAHCNLRLLGSSDSRAS
ASRAAGITGVSHCAQPCLLFEPEFDLLAGVQLLPFEPPTGKALSRKD
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtggcccaacggcagttccctggggccctgtttccggcccacaaacattaccctggag
gagagacggctgatcgcctcgccctggttcgccgcctccttctgcgtggtgggcctggcc
tccaacctgctggccctgagcgtgctggcgggcgcgcggcaggggggttcacacacgcgc
tcctccttcctcaccttcctctgcggcctcgtcctcaccgacttcctggggctgctggtg
accggtaccatcgtggtgtcccagcacgccgcgctcttcgagtggcacgccgtggaccct
ggctgccgtctctgtcgcttcatgggcgtcgtcatgatcttcttcggcctgtccccgctg
ctgctgggggccgccatggcctcagagcgctacctgggcatcacccggcccttctcgcgc
ccggcggtcgcctcgcagcgccgcgcctgggccaccgtggggctggtgtgggcggccgcg
ctggcgctgggcctgctgcccctgctgggcgtgggtcgctacaccgtgcaatacccgggg
tcctggtgcttcctgacgctgggcgccgagtccggggacgtggccttcgggctgctcttc
tccatgctgggcggcctctcggtcgggctgtccttcctgctgaacacggtcagcgtggcc
accctgtgccacgtctaccacgggcaggaggcggcccagcagcgtccccgggactccgag
gtggagatgatggctcagctcctggggatcatggtggtggccagcgtgtgttggctgccc
ctgctggtcttcatcgcccagacagtgctacgaaacccacctgccatgagccccgccggg
cagctgtcccgcgccacggagaaggagctgctcatctacttgcgcgtggccacctggaac
cagatcctggacccctgggtgtacatcctgttccgccgcgccgtgctccggcgtctccag
cctcgcctcagcacccggcccaggtcgcttctcactctgtggcccagcctggagtacagt
ggcatgatctcggctcactgcaacctccgcctcctgggttcaagcgattctcgtgcctca
gcctcccgagcagctgggattacaggcgtaagccactgcgcccagccttgcttgctcttt
gaacctgaatttgacctacttgctggggtacagttgcttccttttgaacctccaacaggg
aaggctctgtccagaaaggattga

KEGG   Pan paniscus (bonobo): 100988134
Entry
100988134         CDS       T02283                                 

Gene name
GRM5
Definition
(RefSeq) glutamate metabotropic receptor 5
  KO
K04604  metabotropic glutamate receptor 5
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04072  Phospholipase D signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04540  Gap junction
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps05010  Alzheimer disease
pps05016  Huntington disease
pps05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100988134 (GRM5)
   04072 Phospholipase D signaling pathway
    100988134 (GRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100988134 (GRM5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100988134 (GRM5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100988134 (GRM5)
   04720 Long-term potentiation
    100988134 (GRM5)
   04723 Retrograde endocannabinoid signaling
    100988134 (GRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100988134 (GRM5)
   05016 Huntington disease
    100988134 (GRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    100988134 (GRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100988134 (GRM5)
G protein-coupled receptors [BR:pps04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   100988134 (GRM5)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G Peripla_BP_6 DUF5438
Other DBs
NCBI-GeneID: 100988134
NCBI-ProteinID: XP_003833036
Position
11
AA seq 1210 aa
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGAGGSAGGVGATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPSPI
STLSHRAGSASRTDDDVPSLHSEPVARSSSSQGSLMEQISSVVTRFTANISELNSMMLST
AAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAARE
SPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLII
RDYTQSSSSL
NT seq 3633 nt   +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagtcttacttttgaaagaagatgtccgtgggagtgca
cagtccagtgagaggagggtggtggctcacatgccgggtgacatcattattggagctctc
ttttctgttcatcaccagcctactgtggacaaagttcatgagaggaagtgtggggcggtc
cgtgaacagtatggcattcagagagtggaggccatgctgcataccctggaaaggatcaat
tcagaccccacactcttgcccaacatcacactgggctgtgagataagggactcctgctgg
cattcggctgtggccctagagcagagcattgagttcataagagattccctcatttcttca
gaagaggaagagggcttggtacgctgtgtggatggctcctcctcttccttccgctccaag
aagcccatagtaggggtcattgggcctggctccagttctgtagccattcaggtccagaat
ttgctccagcttttcaacatacctcagattgcttactcagcaaccagcatggatctgagt
gacaagactctgttcaaatatttcatgagggttgtgccttcagatgctcagcaggcaagg
gccatggtggacatagtgaagaggtacaactggacctatgtatcagccgtgcacacagaa
ggcaactatggagaaagtgggatggaagccttcaaagatatgtcagcgaaggaagggatt
tgcatcgcccactcttacaaaatctacagtaatgcaggggagcagagctttgataagctg
ctgaagaagctcacaagtcacttgcccaaggcccgggtggtggcctgcttctgtgagggc
atgacggtgagaggtctgctgatggccatgaggcgcctgggtctagcgggagaatttctg
cttctgggcagtgatggctgggctgacaggtatgatgtgacagatggatatcagcgagaa
gctgttggtggcatcacaatcaagctccaatctcccgatgtcaagtggtttgatgattat
tatctgaagctccggccagaaacaaaccaccgaaacccttggtttcaagaattttggcag
catcgttttcagtgccgactggaagggtttccacaggagaacagcaaatacaacaagact
tgcaatagttctctgactctgaaaacacatcatgttcaggattccaaaatgggatttgtg
atcaacgccatctattcgatggcctatgggctccacaacatgcagatgtccctctgccca
ggctatgcaggactctgtgatgccatgaagccaattgatggacggaaacttttggagtcc
ctgatgaaaaccaattttactggggtttctggagatacgatcctattcgatgagaatgga
gactctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattactttgat
tatatcaacgttggaagttgggacaatggagaattaaaaatggatgatgatgaagtatgg
tccaagaaaagcaacatcatcagatctgtgtgcagtgaaccatgtgagaaaggccagatc
aaggtgatccgaaagggagaagtcagctgttgttggacctgtacaccttgtaaggagaat
gagtatgtctttgatgagtacacatgcaaggcatgccaactggggtcttggcccactgat
gatctcacaggttgtgacttgatcccagtacagtatcttcgatggggtgaccctgaaccc
attgcagctgtggtgtttgcctgccttggcctcctggccaccctgtttgttactgtagtc
ttcatcatttaccgtgatacaccagtagtcaagtcctcaagcagggaactctgctacatt
atccttgctggcatctgcctgggctacttatgtaccttctgcctcattgcgaagcccaaa
cagatttactgctaccttcagagaattggcattggtctctccccagccatgagctactca
gcccttgtaacaaagaccaaccgtattgcaaggatcctggctggcagcaagaagaagatc
tgtaccaaaaagcccagattcatgagtgcctgtgcccagctagtgattgctttcattctc
atatgcatccagttgggcatcatcgttgccctctttataatggagcctcctgacataatg
catgactacccaagcattcgagaagtctacctgatctgtaacaccaccaacctaggagtt
gtcactccacttggatacaatggattgttgattttgagctgcaccttctatgcgttcaag
accagaaatgttccagctaacttcaacgaggccaagtatatcgccttcacaatgtacacg
acctgcattatatggctagcttttgtgccaatctactttggcagcaactacaaaatcatc
accatgtgtttctcggtcagcctcagtgccacagtggccctaggctgcatgtttgtgccg
aaggtgtacatcatcctggccaaaccagagagaaacgtgcgcagcgccttcaccacatct
accgtggtgcgcatgcatgtaggggatggcaagtcatcctccgcagccagcagatccagc
agcctagtcaacctgtggaagagaaggggctcctctggggaaaccttaaggtacaaagac
aggagactggcccagcacaagtcggaaatagagtgtttcacccccaaagggagtatgggg
aatggtgggagagcaacaatgagcagttccaatggaaaatccgtcacgtgggcccagaat
gagaagagcagccgggggcagcacctgtggcagcgcctgtccatccacatcaacaagaaa
gaaaaccccaaccaaacggccgtcatcaagcccttccccaagagcacggagagccgtggc
ctgggcgctggcgcaggcgggagcgctgggggcgtgggggccacgggcggtgcgggctgc
gcaggcgccggcccaggcgggcccgagtccccagacgccggccccaaggcgctgtatgat
gtggccgaggctgaggagcacttcccggcgcccgcgcggccgcgctcaccgtcgcccatc
agcacgctgagccaccgcgcgggctcggctagccgcacggacgacgatgtgccgtcgctg
cactcggagcctgtggcgcgcagcagctcctcgcagggctccctcatggagcagatcagc
agtgtggtcacccgcttcacggccaacatcagcgagctcaactccatgatgctgtccacc
gcggcccccagccccggcgtcggcgccccgctctgctcgtcctacctgatccccaaagag
atccagttgcccacgaccatgacgacctttgccgaaatccagcctctgccggccatcgag
gtcacgggcggcgcgcagcccgcggcaggggcgcaggcggctggggacgcggcccgggag
agccccgcggccggtcccgaggctgcggccgccaagccagacctggaggagttggtggct
ctcaccccgccgtcccccttcagagactcggtggactcggggagcacaacccccaactcg
ccagtgtccgagtcggccctctgtatcccatcgtctcccaaatatgacactcttatcata
agagattacactcagagctcctcgtcgttgtga

KEGG   Pan paniscus (bonobo): 100988950
Entry
100988950         CDS       T02283                                 

Gene name
CYSLTR1
Definition
(RefSeq) cysteinyl leukotriene receptor 1
  KO
K04322  cysteinyl leukotriene receptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100988950 (CYSLTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100988950 (CYSLTR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100988950 (CYSLTR1)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Lipid
   Cysteinyl leukotriene
    100988950 (CYSLTR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srx 7TM_GPCR_Srv DUF4064 DUF420 COX7C TMEM70 MscS_TM TMEM234
Other DBs
NCBI-GeneID: 100988950
NCBI-ProteinID: XP_003824461
UniProt: A0A2R8ZA68
Position
X
AA seq 337 aa
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHEKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHSETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggatgaaacaggaaatctgacggtatcttctgccacatgccatgacactattgatgac
ttccgcaatcaagtgtattccaccttgtactctatgatctctgttgtaggcttctttggc
aatggctttgtgctctatgtcctcataaaaacctatcatgagaagtcagccttccaagta
tacatgattaatttagcagtagcagatctactttgtgtgtgcacactgcctctccgtgtg
gtctattatgttcacaaaggtatttggctctttggtgacttcttgtgccgcctcagcacc
tatgctttgtatgtcaacctctattgtagcatcttctttatgacagccatgagctttttc
cggtgcattgcaattgtttttccagtccagaacattaatttggttacacagaaaaaagcc
aggtttgtgtgtgtaggtatttggatttttgtgattttgaccagttctccatttctaatg
gccaaaccacaaaaagatgagaaaaataataccaagtgctttgagcccccacaagacaat
caaactaaaaatcatgttttggtcttgcattatgtgtcattgtttgttggctttatcatc
ccttttgttattataattgtctgttacacaatgatcattttgaccttactaaaaaaatca
atgaaaaaaaatctgtcaagtcataaaaaggctataggaatgatcatggtcgtgaccgct
gcctttttagtcagtttcatgccatatcatattcaacgtaccattcaccttcatttttta
cacagtgaaactaaaccctgtgattctgtccttagaatgcagaagtccgtggtcataacc
ttgtctctggctgcatccaattgttgctttgaccctctcctatatttcttttctgggggt
aactttaggaaaaggctgtcgacatttagaaagcattctttgtccagcgtgacttatgta
cccagaaagaaggcctctttgccagaaaaaggagaagaaatatgtaaagtatag

KEGG   Pan paniscus (bonobo): 100989161
Entry
100989161         CDS       T02283                                 

Gene name
LHCGR
Definition
(RefSeq) luteinizing hormone/choriogonadotropin receptor
  KO
K04248  lutropin-choriogonadotropic hormone receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04913  Ovarian steroidogenesis
pps04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100989161 (LHCGR)
   04024 cAMP signaling pathway
    100989161 (LHCGR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100989161 (LHCGR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100989161 (LHCGR)
   04917 Prolactin signaling pathway
    100989161 (LHCGR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100989161 (LHCGR)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Lutropin-choriogonadotropic hormone
    100989161 (LHCGR)
SSDB
Motif
Pfam: 7tm_1 LRR_8 LRR_5 Comm LRR_4
Other DBs
NCBI-GeneID: 100989161
NCBI-ProteinID: XP_003822738
UniProt: A0A2R9APW3
Position
2A
AA seq 699 aa
MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLP
VKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFI
NLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLK
LYGNGFEEVQSHAFNGTTLTALELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSY
GLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
SKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAFNPCEDIMGYD
FLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDS
QTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRL
RHAILIMLGGWLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFF
IICACYIKIYFAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLIT
VTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCCKRRAELYRRKDFSAYT
SNCKNGFTGSNKPSQPTLKLSTLHCQGTALLDKTCYTEC
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgaagcagcggttctcggcgctgcagctgctgaagctgctgctgctgctgcagccgccg
ctgccacgagcgctgcgcgaggcgctctgccctgagccctgcaactgcgtgcccgacggc
gccctgcgctgccccggccccacggccggtctcactcgactatcacttgcctacctccct
gtcaaagtgatcccatctcaagctttcagaggacttaatgaggtcataaaaattgaaatc
tctcagattgattccctggaaaggatagaagctaatgcctttgacaacctcctcaatttg
tctgaaatactgatccagaacaccaaaaatctgagatacattgagcccggagcatttata
aatcttccccgattaaaatacttgagcatctgtaacacaggcatcagaaagtttccagat
gttacgaaggtcttctcctctgaatcaaatttcattctggaaatttgtgataacttacac
ataaccaccataccaggaaatgcttttcaagggatgaataatgaatctgtaacactcaaa
ctatatggaaatggatttgaagaagtacaaagtcatgcgttcaatgggacgacgctgact
gcactggagctaaaggaaaacgtacatctggagaagatgcacaatggagccttccgtggg
gccacagggccgaaaactttggatatttcttccaccaaattgcaggccctgccgagctat
ggcctagagtccattcagaggctaattgccacgtcatcctattctctaaaaaaattgcca
tcaagagaaacatttgtcaatctcctggaggccacgttgacttaccccagccactgctgt
gcttttagaaacttgccaacaaaagaacagaatttttcacattccatttctgaaaacttt
tccaaacaatgtgaaagcacagtaaggaaagtgaataataaaacactttattcttccatg
cttgctgagagtgaactgagtggctgggactatgaatatggtttctgcttacccaagaca
ccccgatgtgctcctgaaccagatgcttttaatccctgtgaagatattatgggctatgac
ttccttagggtcctgatttggctgattaatattctagccatcatgggaaacatgactgtt
ctttttgttctcctgacaagtcgttacaaacttacagtgcctcgttttctcatgtgcaat
ctctcctttgcagacttttgcatggggctctatctgctgctcatagcctcagttgattcc
caaaccaagggccagtactataaccatgccatagactggcagacagggagtgggtgcagc
actgctggctttttcactgtattcgcaagtgaactttctgtctacaccctcaccgtcatc
actctagaaagatggcacaccatcacctatgctattcacctggaccaaaagctgcgatta
agacatgccattctgattatgcttggaggatggctcttttcttctctaattgctatgttg
ccccttgtcggtgtcagcaattacatgaaggtcagtatttgcttccccatggatgtggaa
accactctctcacaagtctatatattaaccatcctgattctcaatgtggtggccttcttc
ataatttgtgcttgctacattaaaatttattttgcagttcgaaacccagaattaatggct
accaataaagatacaaagattgctaagaaaatggcaatcctcatcttcaccgatttcacc
tgcatggcacctatctctttttttgccatctcagctgccttcaaagtacctcttatcaca
gtaaccaactctaaagttttactggttcttttttatcccatcaattcttgtgccaatcca
tttctgtatgcaatattcactaagacattccaaagagatttctttctgttgctgagcaaa
tttggctgctgtaaacgtcgggctgaactttatagaaggaaagatttttcagcttacacc
tccaactgcaaaaatggcttcactggatcaaataagccttctcaacccaccttgaagttg
tccacattgcactgtcaaggtacagctctcctagacaagacttgctacacagagtgttaa

KEGG   Pan paniscus (bonobo): 100989641
Entry
100989641         CDS       T02283                                 

Gene name
CHRM3
Definition
(RefSeq) cholinergic receptor muscarinic 3
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04725  Cholinergic synapse
pps04742  Taste transduction
pps04810  Regulation of actin cytoskeleton
pps04911  Insulin secretion
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps05010  Alzheimer disease
pps05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100989641 (CHRM3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100989641 (CHRM3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100989641 (CHRM3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100989641 (CHRM3)
  09154 Digestive system
   04970 Salivary secretion
    100989641 (CHRM3)
   04971 Gastric acid secretion
    100989641 (CHRM3)
   04972 Pancreatic secretion
    100989641 (CHRM3)
  09156 Nervous system
   04725 Cholinergic synapse
    100989641 (CHRM3)
  09157 Sensory system
   04742 Taste transduction
    100989641 (CHRM3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100989641 (CHRM3)
   05022 Pathways of neurodegeneration - multiple diseases
    100989641 (CHRM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100989641 (CHRM3)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    100989641 (CHRM3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 100989641
NCBI-ProteinID: XP_014198833
Position
1
AA seq 590 aa
MTLHNNSTTLPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDXKKRRKQQYQQRQSVIFHKRAPEQAL
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgaccttgcacaataacagtacaaccttgcctttgtttccaaacatcagctcttcctgg
atacacagcccctccgatgcagggctgcccccgggaaccgtcactcatttcggcagctac
aatgtttctcgagcagctggcaatttctcctctccagacggtaccaccgatgaccctctg
ggaggtcataccgtctggcaagtggtcttcatcgctttcttaacgggcatcctggccttg
gtgaccatcatcggcaacatcctggtaattgtgtcatttaaggtcaacaagcagctgaag
acggtcaacaactacttcctcttaagcctggcctgtgccgatctgattatcggggtcatt
tcaatgaatctgtttacgacctacatcatcatgaatcgatgggccttagggaacttggcc
tgtgacctctggcttgccattgactacgtagccagcaatgcctctgttatgaatcttctg
gtcatcagctttgacagatacttttccatcacgaggccgcttacgtaccgagccaaacga
acaacaaagagagctggtgtgatgatcggtctggcttgggtcatctcctttgtcctttgg
gctcctgccatcttgttctggcaatactttgttggaaagagaactgtgcctccgggagag
tgcttcattcagttcctcagtgagcccaccattacttttggcacagccatcgctgctttt
tatatgcctgtcaccattatgactattttatactggaggatctataaggaaaccgaaaag
cgtaccaaagagcttgctggcctgcaagcctctgggacagaggcagagacagaaaacttt
gtccaccccacgggcagttctcgaagctgcagcagttacgaacttcaacagcaaagcatg
aaacgctccaacaggaggaagtatggccgctgccacttctggttcacaaccaagagctgg
aaacccagctccgagcagatggaccaagaccacagcagcagtgacagttggaacaacaat
gatgctgctgcctccctggagaactccgcctcctccgacgaggaggacattggctccgag
acgagagccatctactccatcgtgctcaagcttccgggtcacagcaccatcctcaactcc
accaagttaccctcatcggacaacctgcaggtgcctgaggaggagctggggatggtggac
ttggagaggaaagccgacaagctgcaggcccagaagagcgtggacgatggaggcagtttt
ccaaaaagcttctccaagcttcccatccagctagagtcagccgtggacacagctaagact
tctgacgtcaactcctcagtgggtaagagcacagccactctacctctgtccttcaaggaa
gccactctggccaagaggtttgctctgaagaccagaagtcagatcactaagcggaaaagg
atgtccctcgtcaaggagaagaaagcggcccagaccctcagtgcgatcttgcttgccttc
atcatcacttggaccccatacaacatcatggttctggtgaacaccttttgtgacagctgc
atacccaaaaccttttggaatctgggctactggctgtgctacatcaacagcaccgtgaac
cccgtgtgctatgctctgtgcaacaaaacattcagaaccactttcaagatgctgctgctg
tgccagtgtgacnaaaaaaagaggcgcaagcagcagtaccagcagagacagtcggtcatt
tttcacaagcgcgcacccgagcaggccttgtag

KEGG   Pan paniscus (bonobo): 100992141
Entry
100992141         CDS       T02283                                 

Gene name
NTSR1
Definition
(RefSeq) neurotensin receptor 1
  KO
K04211  neurotensin receptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100992141 (NTSR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100992141 (NTSR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100992141 (NTSR1)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Neurotensin
    100992141 (NTSR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100992141
NCBI-ProteinID: XP_003810877
Position
20
AA seq 418 aa
MRLNSSAPGXPGTPAADPFQRAQAGLEEALLAPGFGNASGNASERVLEAPSSELDVNTDI
YSKVLVTAVYLALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLTLLLAM
PVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLM
SRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVCTPTIHTATVKVVIQVN
TFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHSTFSMAIEPGRVQALRH
GVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMVTNALFYVSSTIN
PILYNLVSANFRHIFLATLACLCPVWRRRRKRPAFSRKANSVSSNHTLSSNATRETLY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgcgcctcaacagctccgcgccggganacccgggcacgccggccgccgaccccttccag
cgggcgcaggccggactggaggaggcgctgctggccccgggcttcggcaacgcttcgggc
aacgcgtcggagcgcgtcctggaggcacccagcagcgagctggacgtgaacaccgacatc
tactccaaggtgctggtgaccgccgtgtacctggcgctcttcgtggtgggcacggtgggc
aacacggtgacagcgttcacgctggcgcggaagaagtcgctgcagagcctgcagagcacg
gtgcattaccacctgggcagcctggcgctgtccgacctgctcaccctgctgctggccatg
cccgtggagctgtacaacttcatctgggtgcaccacccctgggccttcggcgacgccggc
tgccgcggctactacttcctgcgcgacgcctgcacctacgccacggccctcaacgtggcc
agcctgagtgtggagcgctacctggccatctgccaccccttcaaggccaagaccctcatg
tcccgaagccgcaccaagaagttcatcagcgccatctggctcgcctcggccctgctggcg
gtgcctatgctgttcaccatgggcgagcagaaccgcagcgccgacggccagcacgccggc
ggcctggtgtgcacccccaccatccacactgccaccgtcaaggtcgtcatacaggtcaac
accttcatgtccttcatattccccatggtggtcatctcggtcctgaacaccatcatcgcc
aacaagctgaccgtcatggtacgccaggcggccgagcagggccaagtgtgcacggtcggg
ggcgagcacagcacattcagcatggccatcgagcctggcagggtccaggccctgcggcac
ggcgtgcgcgtcctacgtgcagtggtcatcgcctttgtggtctgctggctgccctaccat
gtgcggcgcctcatgttctgctacatctcggatgagcagtggactccgttcctctatgac
ttctaccactacttctacatggtgaccaatgcactcttctacgtcagctccaccatcaac
cccatcctgtacaacctcgtctctgccaacttccgccacatcttcctggccacactggcc
tgcctctgcccagtgtggcggcgcaggaggaagaggccagccttctcgaggaaggctaac
agcgtgtccagcaaccacaccctctccagcaatgccacccgcgagacgctgtactag

KEGG   Pan paniscus (bonobo): 100992440
Entry
100992440         CDS       T02283                                 

Gene name
TRHR
Definition
(RefSeq) thyrotropin releasing hormone receptor
  KO
K04282  thyrotropin-releasing hormone receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100992440 (TRHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100992440 (TRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100992440 (TRHR)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Thyrotropin-releasing hormone (TRH)
    100992440 (TRHR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 100992440
NCBI-ProteinID: XP_003821802
UniProt: A0A2R9BSE5
Position
8
AA seq 398 aa
MENETVSELNQTQLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVISCG
YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTH
QNTNLNVNTSNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVVYNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKES
DHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggaaaacgagacagtcagtgaactgaaccaaacacagcttcagccacgagcagtggtg
gccttagaataccaggtggtcaccatcttacttgtgctcattatttgtggcctgggcatt
gtaggcaacatcatggtagtcctggttgtcatgagaaccaagcacatgaggacccccaca
aactgctacctggtgagcctggcagtagctgatctcatggtcttggtggccgcaggcctc
cccaacataacagacagtatctacggttcctgggtctatggctatgttggatgcctctgc
attacttacctccagtatttgggaattaatgcatcctcttgttcaataacagcctttacc
attgagaggtacatagcaatctgtcaccccatcaaagcccagtttctctgcacattttcc
agagccaaaaagattatcatctttgtctgggctttcacatctctttactgtatgctctgg
ttcttcttgctggatctcaatattagcacctacaaagatgctattgtgatatcctgtggc
tacaagatctccaggaattactactcacctatttacctaatggactttggtgtcttttat
gttgtgccaatgatcctggctaccgtcctctatggattcatagctagaatccttttctta
aatcccattccttcagatcctaaagaaaactctaagacatggaaaaatgactcaacccat
cagaacacaaatttgaatgtaaatacttctaatagatgtttcaacagcacagtatcttca
aggaagcaggtcaccaagatgctggcagtggttgtaattctgtttgcccttttatggatg
ccctacaggactctggtggttgtcaactcatttctctccagtcctttccaagaaaattgg
tttttgctcttttgcagaatttgcatttatctcaacagtgccatcaacccggtggtttac
aatctcatgtcccagaaattccgtgcagccttcagaaagctctgcaactgcaagcagaag
ccaacagagaaacctgctaactacagtgtggccctaaattacagcgtcatcaaggagtca
gaccatttcagcacagagcttgatgatatcactgtcactgacacttacctgtctgccaca
aaagtgtcttttgatgacacctgcttggcttctgaggtatcctttagccaaagttga

KEGG   Pan paniscus (bonobo): 100992718
Entry
100992718         CDS       T02283                                 

Gene name
AGTR1
Definition
(RefSeq) angiotensin II receptor type 1
  KO
K04166  angiotensin II receptor type 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04072  Phospholipase D signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04614  Renin-angiotensin system
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04927  Cortisol synthesis and secretion
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04934  Cushing syndrome
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100992718 (AGTR1)
   04020 Calcium signaling pathway
    100992718 (AGTR1)
   04072 Phospholipase D signaling pathway
    100992718 (AGTR1)
   04022 cGMP-PKG signaling pathway
    100992718 (AGTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100992718 (AGTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100992718 (AGTR1)
   04614 Renin-angiotensin system
    100992718 (AGTR1)
   04925 Aldosterone synthesis and secretion
    100992718 (AGTR1)
   04927 Cortisol synthesis and secretion
    100992718 (AGTR1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100992718 (AGTR1)
   04270 Vascular smooth muscle contraction
    100992718 (AGTR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100992718 (AGTR1)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100992718 (AGTR1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100992718 (AGTR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100992718 (AGTR1)
   04934 Cushing syndrome
    100992718 (AGTR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100992718 (AGTR1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100992718 (AGTR1)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100992718 (AGTR1)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Angiotensin
    100992718 (AGTR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100992718
NCBI-ProteinID: XP_008950137
Position
3
AA seq 359 aa
MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNASSSTKKPAPCFEVE
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgattctcaactcttctactgaagatggtattaaaagaatccaagatgattgtcccaaa
gctggaaggcataattacatatttgtcatgattcctactttatacagtatcatctttgtg
gtgggaatatttggaaacagcttggtggtgatagtcatttacttttatatgaagctgaag
actgtggccagtgtttttcttttgaatttagcactggctgacttatgctttttactgact
ttgccactatgggctgtctacacagctatggaataccgctggccctttggcaattaccta
tgtaagattgcttcagccagcgtcagtttcaacctgtacgctagtgtgtttctactcacg
tgtctcagcattgatcgatacctggctattgttcacccaatgaagtcccgccttcgacgc
acaatgcttgtagccaaagtcacctgcatcatcatttggctgctggcaggcttggccagt
ttgccagctataatccatcgaaatgtatttttcattgagaacaccaatattacagtttgt
gctttccattatgagtcccaaaattcaaccctcccgatagggctgggcctgaccaaaaat
atactgggtttcctgtttccttttctgatcattcttacaagttatactcttatttggaag
gccctaaagaaggcttatgaaattcagaagaacaaaccaagaaatgatgatatttttaag
ataattatggcaattgtgcttttctttttcttttcctggattccccaccaaatattcact
tttctggatgtattgattcaactaggcatcatacgtgactgtagaattgcagatattgtg
gacacggccatgcctatcaccatttgtatagcttattttaacaattgcctgaatcctctt
ttttatggctttctggggaaaaaatttaaaaaatattttctccagcttctaaaatatatt
cccccaaaagccaaatcccactcaaacctttcaacaaaaatgagcacgctttcctaccgc
ccctcagataatgcaagctcatccaccaagaagcctgcaccgtgttttgaggttgagtga

KEGG   Pan paniscus (bonobo): 100992776
Entry
100992776         CDS       T02283                                 

Gene name
CCKBR
Definition
(RefSeq) cholecystokinin B receptor
  KO
K04195  cholecystokinin B receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100992776 (CCKBR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100992776 (CCKBR)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100992776 (CCKBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100992776 (CCKBR)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    100992776 (CCKBR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 100992776
NCBI-ProteinID: XP_003819115
UniProt: A0A2R8ZLJ9
Position
11
AA seq 447 aa
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL
YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
LSGLLMVPYPVYTVVQPVGLRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL
ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS
RPALELTALTAPGPGSGSRPAQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG
PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL
PDEDPPTPSIASLSRLSYTTISTLGPG
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggagctgctaaagctgaaccggagcgtgcagggaaccggacccgggccgggggcttcc
ctgtgccgcccgggggcgcctctcctcaacagcagcagtgtgggcaacctcagctgcgag
ccccctcgcattcgcggagccgggacacgagaattggagctggccattagaatcactctt
tacgcagtgatcttcctgatgagcgttggaggaaatgtgctcatcatcgtggtcctggga
ctgagccgccgcctgaggactgtcaccaatgccttcctcctctcactggcagtcagcgac
ctcctgctggctgtggcttgcatgcccttcaccctcctgcccaatctcatgggcacattc
atctttggcacagtcatctgcaaggcggtttcctacctcatgggggtgtctgtgagtgtg
tccacgctaagcctcgtggccatcgcactggagcggtacagcgccatctgccgaccactg
caggcacgagtgtggcagacgcgctcccacgcggctcgcgtgattgtagccacgtggctg
ctgtccggactactcatggtgccctaccccgtgtacactgtcgtgcaaccagtggggctt
cgtgtgctgcagtgcgtgcatcgctggcccagtgcgcgggtccgccagacctggtccgta
ctgctgcttctgctcttgttcttcatcccgggtgtggttatggccgtggcctacgggctt
atctctcgcgagctctacttagggcttcgctttgacggtgacagtgacagcgacagccaa
agcagggtccgaaaccaaggcgggctgccaggtgctgttcaccagaacgggcgttgccgg
cctgagactggcgcggttggcgaagacagcgatggctgctacgtgcaacttccacgttcc
cggcctgccctggagctgacggcgctgacggctcctgggccaggatccggctcccggccc
gcccaggccaagctgctggctaagaagcgcgtggtgcgaatgttgctggtgatcgttgtg
cttttttttctgtgttggttgccagtttatagtgccaacacgtggcgcgcctttgatggc
ccgggtgcacaccgagcactctcgggtgctcctatctccttcattcacttgctgagctat
gcctcggcctgtgtcaaccccctcgtctactgcttcatgcaccgtcgctttcgccaggcc
tgcctggaaacgtgcgctcgctgctgcccccggcctccacgagctcgccccagggctctt
cccgatgaggaccctcccactccctccattgcttcgctgtccaggcttagctacaccact
atcagcacgctgggccctggctga

KEGG   Pan paniscus (bonobo): 100993214
Entry
100993214         CDS       T02283                                 

Gene name
PTGER3
Definition
(RefSeq) prostaglandin E receptor 3
  KO
K04260  prostaglandin E receptor 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04923  Regulation of lipolysis in adipocytes
pps05163  Human cytomegalovirus infection
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100993214 (PTGER3)
   04024 cAMP signaling pathway
    100993214 (PTGER3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100993214 (PTGER3)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100993214 (PTGER3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100993214 (PTGER3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100993214 (PTGER3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100993214 (PTGER3)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    100993214 (PTGER3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 100993214
NCBI-ProteinID: XP_003830641
Position
1
AA seq 365 aa
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQE
EFWGN
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaaggagacccggggctacggaggggatgcccccttctgcacccgcctcaaccactcc
tacacaggcatgtgggcgcccgagcgttccgccgaggcgcggggcaacctcacgcgccct
ccagggtctggcgaggattgcggatcggtgtccgtggccttcccgatcaccatgctgctc
actggtttcgtgggcaacgcactggccatgctgctcgtgtcgcgcagctaccggcgccgg
gagagcaagcgcaagaagtccttcctgctgtgcatcggctggctggcgctcaccgacctg
gtcgggcagcttctcaccaccccggtcgtcatcgtcgtgtacctgtccaagcagcgttgg
gagcacatcgacccgtcggggcggctctgcacctttttcgggctgaccatgactgttttc
gggctctcctcgttgttcatcgccagcgccatggccgtcgagcgggcgctggccatcagg
gcgccgcactggtatgcgagccacatgaagacgcgtgccacccgcgctgtgctgctcggc
gtgtggctggccgtgctcgccttcgccctgctgccggtgctgggcgtgggccagtacacc
gtccagtggcccgggacgtggtgcttcatcagcaccgggcgagggggcaacgggactagc
tcttcgcataactggggcaaccttttcttcgcctctgcctttgccttcctggggctcttg
gcgctgacagtcaccttttcctgcaacctggccaccattaaggccctggtgtcccgctgc
cgggccaaggccacggcatctcagtccagtgcccagtggggccgcatcacgaccgagacg
gccattcagctcatggggatcatgtgcgtgctgtcggtctgctggtctccgctactgata
atgatgttgaaaatgatcttcaatcagacatcagttgagcactgcaagacacacacggag
aagcagaaagaatgcaacttcttcttaatagctgttcgcctggcttcactgaaccagatc
ttggatccttgggtttacctgctgttaagaaagatccttcttcgaaagttttgccaggag
gaattttggggaaattaa

KEGG   Pan paniscus (bonobo): 100993523
Entry
100993523         CDS       T02283                                 

Gene name
AVPR1A
Definition
(RefSeq) arginine vasopressin receptor 1A
  KO
K04226  arginine vasopressin receptor 1A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04072  Phospholipase D signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100993523 (AVPR1A)
   04072 Phospholipase D signaling pathway
    100993523 (AVPR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100993523 (AVPR1A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100993523 (AVPR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100993523 (AVPR1A)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Vasopressin
    100993523 (AVPR1A)
SSDB
Motif
Pfam: 7tm_1 DUF1856 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4
Other DBs
NCBI-GeneID: 100993523
NCBI-ProteinID: XP_003824859
UniProt: A0A2R8ZWK4
Position
12
AA seq 421 aa
MDSMRLSAGPDAGPSGNSSPWWPLATGASNTSREAEALGEGNGPPRDVRNEELAKLEIAV
LAVTFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRF
RGPDWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVL
SFVLSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYG
FICYNIWRNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIV
TAYIVCWAPFFIIQMWSVWDPKSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQ
DCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVS
T
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggacagcatgcgtctctccgccggtcccgacgcggggccctcgggcaactccagccca
tggtggcccctggccaccggcgctagcaacacaagccgggaggccgaagccctcggggaa
ggcaacggcccaccgagggacgtgcgcaacgaggagctggccaaactggagatcgccgtg
ctggcggtgactttcgcggtggccgtgctgggcaacagcagcgtactgctggctctgcac
cggacgccgcgcaagacgtcccgcatgcatctcttcatccgacacctcagcctggccgac
ctggccgtggcattcttccaggtgctgccgcaaatgtgctgggacatcacctaccgcttc
cgcggccccgactggctgtgccgcgtggtgaagcacctgcaggtgttcggcatgttcgcg
tcggcctacatgctggtagtcatgacagccgaccgctacatcgccgtgtgccacccgctc
aagactctgcaacagcccgcgcgccgctcgcgcctcatgatcgcggccgcctgggtgctg
agcttcgtgctgagcacgccgcagtacttcgtcttctccatgatcgaggtgaacaatgtc
accaaggcccgcgactgctgggccaccttcatccagccctggggttctcgtgcctacgtg
acctggatgacgggcggcatctttgtggcgcccgtggtcatcttgggtacctgctacggc
ttcatctgctacaacatctggcgcaacgtccgcgggaagacggcgtcgcgccagagcaag
ggtgcagagcaagcgggtgtggccttccaaaaggggttcctgctcgcaccctgtgtcagc
agcgtgaagtccatttcccgggccaagatccgcacggtgaagatgacttttgtgatcgtg
acggcttacatcgtctgctgggcgcctttcttcatcatccagatgtggtctgtctgggat
cccaagtccgtctggaccgaatcggaaaaccctaccatcaccatcactgcattactgggt
tccttgaacagctgctgtaatccctggatatacatgttttttagtggccatctccttcag
gactgtgttcaaagcttcccatgctgccaaaacatgaaggaaaaattcaacaaagaagat
actgacagtatgagcagaagacagactttttattctaacaatcgaagcccaacaaacagc
acgggtatgtggaaggactcgcctaaatcttccaagtccatcaaattcattcctgtttca
acttga

KEGG   Pan paniscus (bonobo): 100995235
Entry
100995235         CDS       T02283                                 

Gene name
CCKAR
Definition
(RefSeq) cholecystokinin A receptor
  KO
K04194  cholecystokinin A receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04911  Insulin secretion
pps04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100995235 (CCKAR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100995235 (CCKAR)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100995235 (CCKAR)
  09154 Digestive system
   04972 Pancreatic secretion
    100995235 (CCKAR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100995235 (CCKAR)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    100995235 (CCKAR)
SSDB
Motif
Pfam: 7tm_1 CholecysA-Rec_N 7TM_GPCR_Srsx 7tm_4 DUF6338
Other DBs
NCBI-GeneID: 100995235
NCBI-ProteinID: XP_003826891
UniProt: A0A2R8ZVR1
Position
4
AA seq 428 aa
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGRTTGASLSRFSYSH
MSASAPPQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggatgtggttgacagccttcttgtgaatggaagcaacatcactcctccctgcgaactc
gggctcgaaaatgagacgcttttctgcttggatcagccccgtccttccaaagagtggcag
ccagcggtgcagattctcttgtactccttgatattcctgctcagcgtgctgggaaacacg
ctggtcatcaccgtgctgattcggaacaagcggatgcggacggtcaccaacatcttcctc
ctctccctggctgtcagcgacctcatgctctgtctcttctgcatgccgttcaacctcatc
cccaatctgctcaaggatttcatcttcgggagcgccgtttgcaagaccaccacctacttc
atgggcacctctgtgagtgtatctacctttaatctggtagccatatctctagagagatac
ggtgcgatttgcaaacccttacagtcccgggtctggcagacaaaatcccatgctttgaag
gtgattgctgctacctggtgcctttcctttaccatcatgactccgtaccccatttatagc
aacttggtgccttttaccaaaaataacaaccagaccgcgaatatgtgccgctttctactg
ccaaatgatgttatgcagcagtcctggcacacattcctgttactcatcctctttcttatt
cctggaattgtgatgatggtggcatatggattaatctctttggaactctaccagggaata
aaatttgaggctagccagaagaagtctgctaaagaaaggaaacctagcaccaccagcagc
ggcaaatatgaggacagcgatgggtgttacctgcaaaagaccaggcccccgaggaagctg
gagctccggcagctgtccactggcagcagcagcagggccaaccgcatccggagcaacagc
tccgcagccaacctgatggccaagaaaagggtgatccgcatgctcatcgtcatcgtggtc
ctcttcttcctgtgctggatgcccatcttcagcgccaacgcctggcgggcctacgacacc
gcctccgcagagcgccgcctctcaggaacccccatttccttcatcctcctcctgtcctac
acctcctcctgcgtcaaccccatcatctactgcttcatgaacaaacgcttccgcctcggc
ttcatggccaccttcccctgctgccccaatcctggtcccccaggggcgaggggagaggtg
ggggaggaggaggaaggcaggaccacaggagcctctctgtccaggttctcgtacagccat
atgagtgcctcggcgccaccccagtga

KEGG   Pan paniscus (bonobo): 100995333
Entry
100995333         CDS       T02283                                 

Gene name
AVPR1B
Definition
(RefSeq) arginine vasopressin receptor 1B
  KO
K04227  arginine vasopressin receptor 1B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04072  Phospholipase D signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100995333 (AVPR1B)
   04072 Phospholipase D signaling pathway
    100995333 (AVPR1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100995333 (AVPR1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100995333 (AVPR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100995333 (AVPR1B)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Vasopressin
    100995333 (AVPR1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF1856 7TM_GPCR_Srv 7tm_4 Srg 7TM_GPCR_Srx DUF5134
Other DBs
NCBI-GeneID: 100995333
NCBI-ProteinID: XP_003822978
UniProt: A0A2R9BIK4
Position
1
AA seq 424 aa
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSRQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
SGVLDCWADFRFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKIQAWRVG
GGVWRTWDRPSPSTSAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPQPLRHLACCGGPQ
PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADREGTAE
TIIF
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggattctgggcctctgtgggatgccaaccccacccctcggggcaccctctctgccccc
aatgccacaacaccctggctgggccgggatgaggagctggccaaggtggagatcggagtc
ctggccactgtcctggtgctggcgaccgggggcaacctggctgtgctgctgaccctgggc
cagctgggccgcaagcgctcccgcatgcacctgttcgtgctgcacctagccctgacagac
ctggctgtggcgctcttccaggtgctgccacagctgctgtgggacatcacctaccgcttc
cagggccccgacctcctgtgcagggccgtcaagtacctgcaggtgctcagcatgtttgcc
tccacctacatgctgctggccatgacgctggaccgctacctggctgtctgtcaccccctg
cgcagccgccagcagccaggccagtccacctacctgctcatcgctgctccctggctgctg
gccgccatcttcagcctccctcaagttttcattttttccctgcgggaggtgatccagggc
tcaggggtgctggactgctgggcagacttccgcttcccttgggggccacgggcgtacctc
acctggaccaccctggctatcttcgttctgccggtgaccatgctcacggcctgctacagc
ctcatctgccatgagatctgtaaaaacctaaaagtcaagatacaggcctggcgggtggga
ggaggggtctggaggacttgggacaggccctcaccttccacctcagctgccaccactcgg
gggctgccatctcgggtcagcagtatcaacaccatctcacgggccaagatccgaacagtg
aagatgacctttgtcatcgtgctggcctacatcgcttgctgggctcccttcttcagtgtc
cagatgtggtccgtgtgggacaagaatgcccctgatgaagattccaccaatgtggctttc
accatctctatgcttttgggcaacctcaacagctgctgcaacccctggatctacatgggc
ttcaacagccacctgttaccgcagcccctgcgtcaccttgcctgctgtgggggtccccag
cccaggatgcgccggcggctctccgacggcagcctctcgagccgccacaccacgctgctg
acccgctccagctgcccggccaccctcagcctcagcctcagcctaaccctcagtgggagg
cccaggcctgaagagtcaccaagggacttggagctggcggatcgggaaggcaccgctgag
accatcatcttttag

KEGG   Pan paniscus (bonobo): 103782638
Entry
103782638         CDS       T02283                                 

Gene name
CHRM2
Definition
(RefSeq) cholinergic receptor muscarinic 2
  KO
K04130  muscarinic acetylcholine receptor M2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04151  PI3K-Akt signaling pathway
pps04725  Cholinergic synapse
pps04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103782638 (CHRM2)
   04024 cAMP signaling pathway
    103782638 (CHRM2)
   04151 PI3K-Akt signaling pathway
    103782638 (CHRM2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103782638 (CHRM2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103782638 (CHRM2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    103782638 (CHRM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    103782638 (CHRM2)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    103782638 (CHRM2)
SSDB
Motif
Pfam: 7tm_1 7tm_4 Macoilin
Other DBs
NCBI-GeneID: 103782638
NCBI-ProteinID: XP_008964237
UniProt: A0A2R8Z7A8
Position
7
AA seq 466 aa
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaataactcaacaaactcctctaacaatagcctggctcttacaagtccttataagaca
tttgaagtggtgtttattgtcctggtggctggatccctcagtttggtgaccattatcggg
aacatcctagtcatggtttccattaaagtcaaccgccacctccagaccgtcaacaattac
tttttattcagcttggcctgtgctgaccttatcataggtgttttctccatgaacttgtac
accctctacactgtgattggttactggcctttgggacctgtggtgtgtgacctttggcta
gccctggactatgtggtcagcaatgcctcagttatgaatctgctcatcatcagctttgac
aggtacttctgtgtcacaaaacctctgacctacccagtcaagcggaccacaaaaatggca
ggtatgatgattgcagctgcctgggtcctctctttcatcctctgggctccagccattctc
ttctggcagttcattgtaggggtgagaactgtggaggatggggagtgctacattcagttt
ttttccaatgctgctgtcacctttggtacggctattgcagccttctatttgccagtgatc
atcatgactgtgctatattggcacatatcccgagccagcaagagcaggataaagaaggac
aagaaagagcctgttgccaaccaagaccctgtttctccaagtctggtacaaggaaggata
gtgaagccaaacaataacaacatgcccagcagtgacgatggcctggagcacaacaaaatc
cagaatggcaaagcccccagggatcctgtgactgaaaactgtgttcagggagaggagaag
gagagctccaatgactccacctcagtcagtgctgttgcctctaatatgagagatgatgaa
ataacccaggatgaaaacacagtttccacttccctgggccattccaaagatgagaactct
aagcaaacatgcatcagaattggcaccaagaccccaaaaagtgactcatgtaccccaact
aataccaccgtggaggtagtggggtcttcaggtcagaatggagatgaaaagcagaatatt
gtagcccgcaagattgtgaagatgactaagcagcctgcaaaaaagaagcctcctccttcc
cgggaaaagaaagtcaccaggacaatcttggctattctgttggctttcatcatcacttgg
gccccatacaatgtcatggtgctcattaacaccttttgtgcaccttgcatccccaacact
gtgtggacaattggttactggctttgttacatcaacagcactatcaaccctgcctgctat
gcactttgtaatgccaccttcaagaagacctttaaacaccttctcatgtgtcattataag
aacataggcgctacaaggtaa

KEGG   Pan paniscus (bonobo): 106634821
Entry
106634821         CDS       T02283                                 

Gene name
ADRA1B
Definition
(RefSeq) adrenoceptor alpha 1B
  KO
K04136  adrenergic receptor alpha-1B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    106634821 (ADRA1B)
   04022 cGMP-PKG signaling pathway
    106634821 (ADRA1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106634821 (ADRA1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106634821 (ADRA1B)
   04270 Vascular smooth muscle contraction
    106634821 (ADRA1B)
  09154 Digestive system
   04970 Salivary secretion
    106634821 (ADRA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    106634821 (ADRA1B)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    106634821 (ADRA1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv GTP_cyclohydro2
Other DBs
NCBI-GeneID: 106634821
NCBI-ProteinID: XP_014200621
Position
5
AA seq 366 aa
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLESKGSLSLKTLNACCKSRKEMNEHNLNLSSLESGHVRDTGATLH
HHIIRF
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaatcccgacctggacaccggccacaacacatcagcacctgcccactggggagagttg
aaaaatgccaacttcactggccccaaccagacctcgagcaactccacactgccccagctg
gacatcaccagggccatctctgtgggcctggtgctgggcgccttcatcctctttgccatc
gtgggcaacatcctagtcatcttgtctgtggcctgcaaccggcacctgcggacgcccacc
aactacttcattgtcaacctggccatggccgacctgctgttgagcttcaccgtcctgccc
ttctcagcggccctagaggtgctcggctactgggtgctggggcggatcttctgtgacatc
tgggcagccgtggatgtcctgtgctgcacagcgtccattctgagcctgtgcgccatctcc
atcgatcgctacatcggggtgcgctactctctgcagtatcccacgctggtcacccggagg
aaggccatcttggcgctgctcagtgtctgggtcttgtccaccgtcatctccatcgggcct
ctcctaggatggaaggagccggcacctaacgatgacaaggagtgcggggtcaccgaagaa
cccttctatgccctcttctcctctctgggctccttctacatccctctggcggtcattcta
gtcatgtactgccgtgtctatatagtggccaagagaaccaccaagaacctagaggcagga
gtcatgaaggagatgtccaactccaaggagctgaccctgaggatccattccaagaacttt
cacgaggacacccttagcagtaccaaggccaagggccacaaccccaggagttccatagct
gtcaaactttttaagttctccagggaaaagaaagcagctaagacgttgggcattgtggtc
ggtatgttcatcttgtgctggctacccttcttcatcgctctaccgcttgaaagcaaaggc
tctttaagcttgaagacgttgaatgcttgctgtaaatccaggaaagaaatgaatgagcac
aatttaaatctctccagcctagagtctggccacgtgagggacacgggagctacattgcat
caccatattatccgtttttga

DBGET integrated database retrieval system