KEGG   Pan paniscus (bonobo): 100968452
Entry
100968452         CDS       T02283                                 

Gene name
HRC
Definition
(RefSeq) histidine rich calcium binding protein
  KO
K23450  sarcoplasmic reticulum histidine-rich calcium-binding protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100968452 (HRC)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100968452 (HRC)
SSDB
Motif
Pfam: Hist_rich_Ca-bd
Other DBs
NCBI-GeneID: 100968452
NCBI-ProteinID: XP_008965177
Position
19
AA seq 743 aa
MGHHRPWLHTSVLWAGVASLLLPPAMTQQLRGDGLGFRNWNNNTGVAGLSEEASAELRHH
LRSPRDHPDENKDVSTENGRHFWSHPDREKEDEDVSKEYGHLLPGHRSQDHKVRDEDVSG
EEVFAEHGGQARGHRGHGSEDTEDSAEHRHHLPSHRSHSHQDEDEDEVVSGEHHHHILRH
GHRGHDGEDDEGQEEEEEEEEEVSTEYGHQAHRHRGHGSEEDEDVSDGHHHHGPSHRHQG
HEEDDNDDDDDDDDDDDDDVSIEYRHQAHRHQGHGIEEDEDVSDGHHHRDPSHRHRSHEE
DDDDDDVSTDYGHQAHRHGGRRKEEDEDVSDEHHHHSPSHRHRGHKEEDDDDDVSTEYGH
QAHRHQDHRKEEVEAVSGEHHHHVPDHRHQGHRDEEKDEDVSTERWHQGPQHVHHGLVDE
EEEEEEITVQFSHYVASHQPRGHKSDEEDFQDEYKTEVPHHHHHRVPREEDEEVSAELGH
QAPSHRQSHQDEETGHGQRGSIKEMSHHPPGHTVVKDRSHLRKDDSEEEKEKEEDPGSHE
EDDESSEQGEKGTHHGSRDQEDEEDEEEGHGLSLNQEEEEEEDKEEEEEEEDEERREERA
EVGAPLSPDHSEEEEEEEEGLEEDEPRFTIIPNPLDRREEAGGASSEEESGEDTGPQDAQ
EYGNYQPGSLCGYCSFCNRCTECESCHCDEENMGEHCDQCQHCQFCYLCPLVCETVCAPG
SYVDYFSSSLYQALADMLETPEP
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgggccaccataggccatggctgcacacttctgtcctctgggctggggtggccagcctg
ctcctccccccggccatgacccagcagctcagaggggatgggctgggcttcagaaactgg
aacaacaacactggagtcgccgggctctccgaggaggcatcagcagagcttcgccaccac
ctccgcagccctagagaccatccagatgagaataaggatgtttccacagagaatgggcgt
catttctggagccacccagaccgtgaaaaggaggatgaagatgtctccaaggaatatggg
cacctactcccaggccacaggtcccaagaccacaaagtcagagatgaggatgtctcaggt
gaggaggtttttgcagagcatggtgggcaggcccgtgggcacagaggccatgggagtgaa
gacacggaagactcagctgagcacaggcaccacctccccagccacaggagccacagccat
caagacgaggatgaggatgaggttgtgtccggtgagcatcaccatcatatcctcaggcat
ggacaccgaggccatgatggggaagatgatgaaggacaagaggaggaggaggaggaggaa
gaggaggtctccactgagtatggacaccaggcccacaggcaccgaggccatgggagtgaa
gaggatgaggatgtctcagatggacaccatcatcatggccccagccacaggcaccaaggc
catgaagaagatgacaatgatgatgacgatgatgatgatgatgatgatgatgatgatgtc
tccattgaatatagacaccaggctcacaggcaccaaggccacgggattgaagaggatgaa
gatgtctcagatggacaccatcatcgcgaccccagccacaggcaccgaagccatgaagaa
gatgacgatgatgatgatgtctccactgactatggacaccaggcccacaggcacggaggt
cgcagaaaggaagaggatgaggatgtctccgatgaacaccaccatcacagccccagccac
aggcaccgaggccacaaagaagaagatgatgatgatgatgtctccactgagtatggacac
caggcccacaggcaccaagaccacagaaaggaagaggttgaggctgtctcaggtgaacac
caccatcatgtccctgaccacaggcaccaaggccacagagacgaggaaaaagatgaggat
gtgtccactgaacgttggcaccagggtccccaacatgtccaccatggccttgtagatgag
gaagaggaagaagaggagatcacagtccagttcagccactatgttgcaagccaccaacct
cgaggccacaagagtgatgaagaggacttccaagatgagtataaaacagaagtccctcac
catcaccaccacagagtccccagggaggaagatgaggaggtctctgctgagcttggccac
caggcccccagccacaggcaaagccaccaagatgaagaaactggccatggtcaaagaggg
tccatcaaagagatgagccatcaccccccaggacacacagtggtcaaggatagaagccat
ttgaggaaggatgattctgaggaggaaaaggagaaggaagaggaccccggctcccatgag
gaagacgatgaaagttcagagcagggagagaaaggcacccatcatggcagccgggaccag
gaagatgaggaggatgaggaggaaggtcatggcctcagcctgaaccaggaggaggaagaa
gaggaagacaaggaggaggaggaggaggaagaagacgaggagaggagggaagagagggct
gaggttggggccccactgagcccagaccacagcgaggaggaagaggaggaggaggagggg
ctggaggaagatgagccccgcttcaccatcatccccaacccactggacaggagagaggag
gctggaggtgcctccagcgaggaggaaagcggtgaggacacaggtccacaggatgctcag
gagtatgggaactaccagccagggtccctgtgtggctactgctccttctgcaatcgatgc
actgaatgtgagagctgtcactgtgatgaggagaacatgggtgagcactgcgaccagtgc
cagcactgtcagttctgctatctctgcccgctggtctgcgaaacggtctgcgctccagga
agctacgttgactatttctcctcgtccctttatcaggccctggcagacatgctggaaacg
ccggaaccctga

DBGET integrated database retrieval system