KEGG   Pan paniscus (bonobo): 100968994
Entry
100968994         CDS       T02283                                 

Gene name
TNNC2
Definition
(RefSeq) troponin C2, fast skeletal type
  KO
K12042  troponin C, skeletal muscle
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100968994 (TNNC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100968994 (TNNC2)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     100968994 (TNNC2)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg TerB DUF1456 DUF5580 p25-alpha SurA_N_2 DUF533
Other DBs
NCBI-GeneID: 100968994
NCBI-ProteinID: XP_003826032
UniProt: A0A2R9BJT7
Position
20
AA seq 160 aa
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII
EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIF
RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacggaccagcaggctgaggccaggtcctacctcagcgaagagatgatcgctgagttc
aaggctgcctttgacatgtttgatgctgatggtggtggggacatcagcgtcaaggagttg
ggcacggtgatgaggatgctgggccagacacccaccaaggaggagctggacgccatcatc
gaggaggtggatgaggacggcagcggcaccatcgacttcgaggagttcttggtcatgatg
gtgcgccagatgaaagaggacgcgaaagggaagagcgaggaggagctggccgagtgcttc
cgcatcttcgacaggaatgcagacggctacatcgacccggaggagctggctgagattttc
agggcctccggggagcacgtgacggacgaggagatcgaatctctgatgaaagacggcgac
aagaacaacgacggccgcattgacttcgacgagttcctgaagatgatggagggcgtgcag
taa

KEGG   Pan paniscus (bonobo): 100984453
Entry
100984453         CDS       T02283                                 

Gene name
TNNC1
Definition
(RefSeq) troponin C1, slow skeletal and cardiac type
  KO
K05865  troponin C, slow skeletal and cardiac muscles
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04260  Cardiac muscle contraction
pps04261  Adrenergic signaling in cardiomyocytes
pps05410  Hypertrophic cardiomyopathy
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100984453 (TNNC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100984453 (TNNC1)
   04261 Adrenergic signaling in cardiomyocytes
    100984453 (TNNC1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100984453 (TNNC1)
   05414 Dilated cardiomyopathy
    100984453 (TNNC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100984453 (TNNC1)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     100984453 (TNNC1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF5580 EMG1 EF-hand_10
Other DBs
NCBI-GeneID: 100984453
NCBI-ProteinID: XP_003818806
UniProt: A0A2R9BDA3
Position
3
AA seq 161 aa
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgacatctacaaggctgcggtagagcagctgacagaagagcagaaaaatgagttc
aaggcagccttcgacatcttcgtgctgggcgctgaggatggctgcatcagcaccaaggag
ctgggcaaggtgatgaggatgctgggccagaaccccacccctgaggagctgcaggagatg
atcgatgaggtggacgaggacggcagcggcacggtggactttgatgagttcctggtcatg
atggttcggtgcatgaaggacgacagcaaagggaaatctgaggaggagctgtctgacctc
ttccgcatgtttgacaaaaacgctgatggctacatcgacctggatgagctgaagataatg
ctgcaggctacaggcgagaccatcacagaggacgacatcgaggagctcatgaaggacgga
gacaagaacaacgacggccgcatcgactatgatgagttcctggagttcatgaagggtgtg
gagtag

DBGET integrated database retrieval system