KEGG   Pan paniscus (bonobo): 100969236
Entry
100969236         CDS       T02283                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C delta 1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04919  Thyroid hormone signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100969236 (PLCD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100969236 (PLCD1)
   04070 Phosphatidylinositol signaling system
    100969236 (PLCD1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100969236 (PLCD1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100969236 (PLCD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100969236 (PLCD1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100969236 (PLCD1)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100969236 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100969236 (PLCD1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 EF-hand_7 EF-hand_6 PH EF-hand_1 EF-hand_5 TEP1_N
Other DBs
NCBI-GeneID: 100969236
NCBI-ProteinID: XP_003826153
Position
3
AA seq 756 aa
MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
WVLGLHKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFRECDHSQTDSLEDEEIEAFYKMLTQRVEIDRTFAEAVGSGETLSVDQLVTFLQHQ
QREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQ
PLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVIRAIRDYAFKASPYPVILSLENHCTLEQQRVMARHLHAILGPMLLNRPLDG
VTNSLPSPEQLKGKILLKGKKLGGLLPPAGEGGPEATVVSDEDEAAEMEDEAVRSRVQHK
PKEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFV
RHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACG
YVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALVRFLVEDYDASSKNDFIGQST
IPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggactcgggccgggacttcctgaccctgcacggcctacaggatgatgaggatctacag
gcgctgctgaagggcagccagctcctgaaggtgaagtccagctcatggaggagagagcgc
ttctacaagttgcaggaggactgcaagaccatctggcaggagtcccgcaaggtcatgcgg
accccggagtcccagctgttctccatcgaggacattcaggaggtgcgaatggggcaccgc
acggagggtctggagaagttcgcccgtgatgtgcccgaggaccgctgcttctccattgtc
ttcaaggaccagcgcaatacactagacctcatcgccccatcgccagctgatgcccagcac
tgggtgctggggctgcacaagatcatccaccactcaggctccatggaccagcgtcagaag
ctacagcactggattcactcctgcttgcgaaaagctgacaaaaacaaggacaacaagatg
agcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggacgacagctat
gcccggaagatcttcagggagtgtgaccactcccagacagactccctggaggacgaggag
attgaggccttctacaagatgctgacccagcgggtggagatcgaccgcaccttcgccgag
gccgtgggctcaggggagactctgtcggtggatcagttagtgacgttcctgcagcaccag
cagcgggaggaggcggcagggcctgcgctggccctctccctcattgagcgctacgagccc
agcgagactgccaaggcgcagcggcagatgaccaaggacggcttcctcatgtacttactg
tcggctgacggcagcgccttcagcctggcacaccgccgtgtctaccaggacatgggccag
ccgcttagccactacctggtgtcctcttcacacaacacctacctgctggaggaccagcta
gccgggcccagcagcactgaagcctacatccgggcactgtgcaaaggctgccgatgcctg
gagcttgactgctgggacgggcccaaccaggaaccaatcatctaccacggctatactttc
acttccaagatcctcttctgcgatgtgatcagggccatccgggactatgccttcaaggcg
tccccctaccctgtcatcctatccctggagaaccactgcacactggagcagcagcgcgtg
atggcgcggcacctgcacgccatcctgggccccatgctgttgaaccgaccactggatggg
gtcaccaacagcctgccctcccctgagcaactgaaggggaagatcctgctgaaggggaag
aagctcggggggctcctgccccctgcaggggagggtggccctgaggccactgtggtgtca
gacgaagacgaggctgctgagatggaggatgaggcagtgaggagccgtgtgcagcacaag
cccaaggaggacaagctcaggctagcacaggagctctctgacatggtcatttactgcaag
agtgtccactttgggggcttctccagtcctggcacccctggacaggccttctacgagatg
gcgtccttctctgagaaccgtgcccttcgactgctccaagaatcaggaaacggctttgtc
cgccacaacgtggggcacctgagcagaatctacccggctggatggagaacagactcctcc
aactacagccccgtggagatgtggaatgggggctgccagattgtggccctgaatttccag
acacctgggccagagatggacgtgtaccagggccgcttccaggacaacggggcctgtggg
tacgtgctgaagcccgccttcctgcgagaccccaacggcacctttaacccccgcgccctg
gctcaggggccctggtgggcacggaagcggctcaacatcagggtcatttcggggcagcag
ctgccaaaagtcaacaagaataagaattcaattgtggaccccaaagtgacagtggagatc
catggtgtgagccgggacgtggccagccgccagactgctgtcatcaccaacaatggtttc
aacccatggtgggacacggagtttgcgtttgaggtagttgtgcctgaccttgccctcgtc
cgcttcttggtggaagattatgatgcctcctccaagaatgacttcattggccagagtacc
atccccttgaacagcctcaagcaaggataccgccatgtccacctcatgtctaagaacggg
gaccagcatccatcagccaccctctttgtgaagatctccctccaggactag

KEGG   Pan paniscus (bonobo): 100980795
Entry
100980795         CDS       T02283                                 

Gene name
PLCD3
Definition
(RefSeq) phospholipase C delta 3
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04919  Thyroid hormone signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100980795 (PLCD3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100980795 (PLCD3)
   04070 Phosphatidylinositol signaling system
    100980795 (PLCD3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100980795 (PLCD3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100980795 (PLCD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100980795 (PLCD3)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100980795 (PLCD3)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100980795 (PLCD3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100980795 (PLCD3)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_10 EF-hand_like C2 EF-hand_7 S_100 PH FANC_SAP TEP1_N YqzL SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 100980795
NCBI-ProteinID: XP_008952963
Position
17
AA seq 724 aa
MLRGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFLVQHIEAVREGHQSE
GLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLD
HWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSNNDRLEGAEIE
EFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLEDQGEEGATLARAQQLIQTYELNET
AKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISSSHNTYLTDSQIGGP
SSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVRDHAFTLSPY
PVILSLENHCGLEQQAAMARHLCTILGDMLVTQALDSPNPEELPSPEQLKGRVLVKGKKL
PAARSEDGRALSDREEEEEEEEEEEEVEAAAQRRLAKQISPELSALAVYCHATRLRTLHP
APNTPQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQEMWNS
GCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDSTFDPEYPGPPRTTLSIQ
VLTAQQLPKLNAEKPHSIVDPLVRVEIHGVPADCARQETDYVLNNGFNPRWGQTLQFQLR
APELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATLFIQIR
IQCS
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgctgcggggctcccggctccgcaagatccgctcgcgcacgtggcacaaggagcggctg
taccggctgcaggaggacggcctgagcgtgtggttccagcggcgcatcccgcgtgcgcca
tcgcagcacatcttcttagtgcagcacatcgaggcggtccgcgagggccaccagtccgag
ggcctgcggcgcttcgggggtgccttcgcgccggcgcgctgcctcaccatcgccttcaag
ggccgccgcaagaacctggacctggcggcgcccacggctgaggaagcgcagcgctgggtg
cgcggtctgaccaagctccgcgcgcgcctggacgccatgagccagcgcgagcggctagac
cactggatccactcctatctgcaccgggctgactccaaccaggacagcaagatgagcttc
aaggagatcaagagcctgctgagaatggtcaacgtggacatgaacgacatgtacgcctac
ctcctcttcaaggagtgtgaccactccaacaacgaccgtctagagggggctgagatcgag
gagttcctgcggcggctgctgaagcggccggagctggaggagatcttccatcagtactcg
ggcgaggaccgcgtgctgagtgcccccgagctgctggagttcctggaggaccagggcgag
gagggcgccacactggcccgcgcccagcagctcattcagacctatgagctcaacgagaca
gccaagcagcatgagctgatgacactggatggcttcatgatgtacctgttgtcgccagag
ggggctgccttggacaacacccacacgtgtgtgttccaggacatgaaccagcccctcgcc
cactacttcatctcttcctcccacaacacctatctgactgactcccagatcggggggccc
agcagcaccgaggcctacgttagggcctttgcccagggatgccgctgcgtggagctggac
tgctgggaggggccaggaggggagcccgtcatctatcatggccataccctcacctccaag
attctcttccgggacgtggtccaagccgtgcgcgaccatgccttcacgctatccccttac
cctgtcatcctatccctggagaaccactgcgggctggagcagcaggctgccatggcccgc
cacctctgcaccatcctgggggacatgctggtgacacaggcgctggactccccaaatccc
gaggagctgccatccccagagcagctgaagggccgggtcctggtgaagggaaagaagctg
cccgctgctcggagcgaggatggccgggctctgtcggatcgggaggaggaggaggaggag
gaggaggaggaagaggaggtggaggctgcagcgcagaggcggctggccaagcagatctcc
ccggagctgtcggccctggctgtgtactgccacgccacccgcctgcggaccctgcaccct
gcccccaacaccccgcaaccctgccaggtcagctccctcagcgagcgcaaagccaagaaa
ctcattcgggaggcagggaacagctttgtcaggcacaatgcccgccagctgacccgcgtg
tacccgctggggctgcggatgaactcagccaactacagtccccaggagatgtggaactcg
ggctgtcagctggtggccttgaacttccagacgccaggctacgagatggacctcaatgcc
gggcgcttcctagtcaatgggcagtgtggctacgtcctaaaacctgcctgcctgcggcaa
cctgactcgacctttgaccctgagtacccgggacctcccagaaccactctcagcatccag
gtgctgactgcacagcagctacccaagctgaatgccgagaagccacactccattgtggac
cccctggtgcgcgttgagatccatggggtgcccgcagactgtgcccggcaggagactgac
tacgtgctcaacaatggcttcaacccccgctgggggcagaccctgcagttccagctgcgg
gctccggagctggcactggtccggtttgtggtagaagattatgacgccacctcccccaat
gactttgtgggccagtttacactgcctcttagcagcctaaagcaagggtaccgccacata
cacctgctttccaaggacggggcctcactgtcaccagccacgctcttcatccaaatccgc
atccagtgctcctga

KEGG   Pan paniscus (bonobo): 100988032
Entry
100988032         CDS       T02283                                 

Gene name
PLCD4
Definition
(RefSeq) phospholipase C delta 4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04919  Thyroid hormone signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100988032 (PLCD4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100988032 (PLCD4)
   04070 Phosphatidylinositol signaling system
    100988032 (PLCD4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100988032 (PLCD4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100988032 (PLCD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100988032 (PLCD4)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100988032 (PLCD4)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100988032 (PLCD4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100988032 (PLCD4)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 PH GDPD EF-hand_8 PH_12 Wap1 SBP_bac_5
Other DBs
NCBI-GeneID: 100988032
NCBI-ProteinID: XP_008970204
Position
2B
AA seq 861 aa
MASLLQDQLTTDQDLLLMQEGMPMHKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
FSISDVETIRNGHDSELLRSLAEELPLEQGFTVVFHGRRSNLDLVANSVEEALIWMRGLQ
LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
AADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLREKQKERDC
TSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
KDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVLPTQL
PSPEELRRKILVKGKKLTLEEDLEYEEEEAEPELEESELALESQFETEPEPQEQNLQNKD
KKKVVTCPLFCPSICCQIVAQAPISKPESLLLSRQVRQEGEYSGEAVGRGLGWMAIIFFS
LRLLRVQFHLLFHLLQKSKPILCPALSSLVIYLKSVSFRSFTHSKEHYHFYEISSFSETK
AKRLIKEAGNEFVQHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMD
ICDGHFRQNGGCGYVLKPDFLRDIQSSFHPEKPISPFKAQTLLIQVISGQQLPKVDKTKE
GSIVDPLVKVQIFGVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLRFVVMDYD
WKSRNDFIGQYTLPWTCMQQGEPAPLTPGQYPSSGCLPNAVLLPLPGYRHIHLLSKDGIS
LRPASIFVYICIQEGLEGDES
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggcgtccctgctgcaagaccagctgaccactgatcaggacttgctgctgatgcaggaa
ggcatgccgatgcacaaggtgaggtccaaaagctggaagaagctaagatacttcagactt
cagaatgacggcatgacagtctggcatgcacggcaggccaggggcagtgccaagcccagc
ttctcaatctctgatgtggagacaatacgtaatggccatgattccgagttgctgcgtagc
ctggcagaggagctccccctggagcagggcttcaccgttgtcttccatggccgccgctcc
aacctggacctggtggccaacagtgttgaggaggccctgatatggatgcgagggctccag
ctgttggtggatcttgtcaccagcatggaccatcaggagcgcctggaccaatggctgagc
gattggtttcaacgtggagacaaaaatcaggatggtaagatgagtttccaagaagttcag
cggttattgcacctaatgaatgtggaaatggaccaagaatatgccttcagtctttttcag
gcagcagacacgtcccagtctggaaccctggaaggagaagaattcgtacagttctataag
gcattgactaaacgtgctgaggtgcaggaactgtttgaaagtttttcagctgatgggcag
aagctgactctgctggaatttttggatttcctccgagagaagcagaaggagagagactgc
acctctgagcttgctctggaactcattgaccgctatgaaccttcagacagtggcaaactg
cggcatgtgctgagcatggatggcttcctcagctacctctgctctaaggatggagacatc
ttcaacccagcctgcctccccatctatcaggatatgactcaacccctgaaccactacttc
atctgctcttctcataacacctacctagtgggggaccagctttgtggccagagcagcgtc
gagggatatatacgggccctgaagcgggggtgccgctgcgtggaggtggatgtatgggat
ggacctagtggggaacctgtcgtttaccacggacacaccctgacctcccgcatcctgttc
aaagatgtcgtggccacagtagcacagtatgccttccagacgtcagactacccagtcatc
ttgtccctggagacccactgcagctgggagcagcagcagaccatggcccgtcatctgact
gagatcctgggggagcagctgctgagcaccaccttggatggggtgctgcccactcagctg
ccctcacctgaggagcttcggaggaagatcctggtgaaggggaagaagttaacacttgag
gaagacctggaatatgaggaagaggaagcagagcctgagttggaggagtcagaattggcg
ctggagtcccagtttgagactgagcctgagccccaggagcagaaccttcagaataaggac
aaaaagaaggttgtgacgtgcccgctgttttgtccgtctatctgttgtcagattgtggcc
caggctcctatttccaagcctgagtcccttctcttgtcccggcaggtgaggcaggaggga
gaatacagtggggaggcagtgggcagaggtttaggttggatggccattatcttcttctct
ctcagactgctgagggttcaattccatcttcttttccaccttctccagaaatccaagccc
atcttgtgtccagccctctcttccctggttatctacttgaagtctgtctcattccgcagc
ttcacacattcaaaggagcactaccacttctacgagatatcatctttctctgaaaccaag
gccaagcgcctcatcaaggaggctggcaatgagtttgtgcagcacaatacttggcagtta
agccgtgtgtatcccagcggcctgaggacagactcttccaactacaacccccaggaactc
tggaatgcaggctgccagatggtggccatgaatatgcagactgcagggcttgaaatggac
atctgtgatgggcatttccgccagaatggcggctgtggctatgtgctgaagccagacttc
ctgcgtgatatccagagttctttccaccctgagaagcccatcagccctttcaaagcccag
actctcttaatccaggtgatcagcggtcagcaactccccaaagtggacaagaccaaagag
gggtccattgtggatccactggtgaaagtgcagatctttggtgtccgtctagacacagca
cggcaggagaccaactatgtggaaaacaatggttttaatccatactgggggcagacacta
tgtttccgggtgctggtgcctgaacttgccatgctgcgttttgtggtaatggattatgac
tggaaatcccgaaatgactttattggtcagtacaccctgccttggacctgcatgcaacaa
ggtgagccagcccctttgacccctggccaataccccagctctggctgccttcctaatgct
gtcctcctgccccttccaggttaccgccacattcacctgctgtccaaagatggcatcagc
ctccgcccagcttccatctttgtgtatatctgcatccaggaaggcctggagggggatgag
tcctga

DBGET integrated database retrieval system