KEGG   Pan paniscus (bonobo): 100969344
Entry
100969344         CDS       T02283                                 

Gene name
PLCB2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04062  Chemokine signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04310  Wnt signaling pathway
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04621  NOD-like receptor signaling pathway
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04742  Taste transduction
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04973  Carbohydrate digestion and absorption
pps05010  Alzheimer disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05163  Human cytomegalovirus infection
pps05200  Pathways in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100969344 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100969344 (PLCB2)
   04310 Wnt signaling pathway
    100969344 (PLCB2)
   04371 Apelin signaling pathway
    100969344 (PLCB2)
   04020 Calcium signaling pathway
    100969344 (PLCB2)
   04070 Phosphatidylinositol signaling system
    100969344 (PLCB2)
   04072 Phospholipase D signaling pathway
    100969344 (PLCB2)
   04071 Sphingolipid signaling pathway
    100969344 (PLCB2)
   04022 cGMP-PKG signaling pathway
    100969344 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100969344 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100969344 (PLCB2)
   04613 Neutrophil extracellular trap formation
    100969344 (PLCB2)
   04621 NOD-like receptor signaling pathway
    100969344 (PLCB2)
   04062 Chemokine signaling pathway
    100969344 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    100969344 (PLCB2)
   04922 Glucagon signaling pathway
    100969344 (PLCB2)
   04929 GnRH secretion
    100969344 (PLCB2)
   04912 GnRH signaling pathway
    100969344 (PLCB2)
   04915 Estrogen signaling pathway
    100969344 (PLCB2)
   04921 Oxytocin signaling pathway
    100969344 (PLCB2)
   04926 Relaxin signaling pathway
    100969344 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    100969344 (PLCB2)
   04918 Thyroid hormone synthesis
    100969344 (PLCB2)
   04919 Thyroid hormone signaling pathway
    100969344 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    100969344 (PLCB2)
   04916 Melanogenesis
    100969344 (PLCB2)
   04924 Renin secretion
    100969344 (PLCB2)
   04925 Aldosterone synthesis and secretion
    100969344 (PLCB2)
   04927 Cortisol synthesis and secretion
    100969344 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100969344 (PLCB2)
   04270 Vascular smooth muscle contraction
    100969344 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    100969344 (PLCB2)
   04971 Gastric acid secretion
    100969344 (PLCB2)
   04972 Pancreatic secretion
    100969344 (PLCB2)
   04973 Carbohydrate digestion and absorption
    100969344 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100969344 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100969344 (PLCB2)
   04725 Cholinergic synapse
    100969344 (PLCB2)
   04728 Dopaminergic synapse
    100969344 (PLCB2)
   04726 Serotonergic synapse
    100969344 (PLCB2)
   04720 Long-term potentiation
    100969344 (PLCB2)
   04730 Long-term depression
    100969344 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    100969344 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    100969344 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    100969344 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100969344 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100969344 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100969344 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100969344 (PLCB2)
   05142 Chagas disease
    100969344 (PLCB2)
   05143 African trypanosomiasis
    100969344 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100969344 (PLCB2)
   05016 Huntington disease
    100969344 (PLCB2)
   05017 Spinocerebellar ataxia
    100969344 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    100969344 (PLCB2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100969344 (PLCB2)
   05415 Diabetic cardiomyopathy
    100969344 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100969344 (PLCB2)
   04934 Cushing syndrome
    100969344 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100969344 (PLCB2)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100969344 (PLCB2)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100969344 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100969344 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 DUF2586 Gp58
Other DBs
NCBI-GeneID: 100969344
NCBI-ProteinID: XP_003826613
UniProt: A0A2R9BYE2
Position
15
AA seq 1185 aa
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKVWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEINEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGPTSSSKDTGGE
AEGSSPPSAPAGEGTVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFVSFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGL
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVK
LQRRHEKELRELERRGARRWEELLQRGAEQLAELGPPGVGGVGACKLGPGKGSRKKRSLP
REESAGAAPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHAAEQISKMMEL
AREKQAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTTDKMAQERLKREINNSHI
QEVVQVIKQMTENLERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
SVRACLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL
NT seq 3558 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaactacagttgcctctccagttatcctccgtgtg
gatcctaagggctactacttatactggacgtatcaaagtaaggagatggagtttctggat
atcaccagcatccgggatactcgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgacaacagtttcctgctgaagacactcacg
gtggtgtctggcccggacatggtggacctcaccttccacaacttcgtctcctacaaggag
aacgtgggcaaggtctgggctgaggacgtactggccctagtcaaacatccgctgacggcc
aacgcctcccgcagcaccttcctggacaagatccttgtgaagctcaagatgcagctcaac
tctgaagggaagattccggtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccccaaaggcaaaaatgatgccatcaatcct
gaggacttcccagaacctgtctacaagagtttcctcatgagcctctgtcctcggccagaa
ataaatgagatcttcacttcttaccatgctaaggccaaaccctacatgacgaaggagcac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctgttcccg
ccagcacggcctgaccaggtgcagggcctcatcgacaagtatgagcccagtggcatcaat
gcacagaggggccagctgtcacctgaaggcatggtctggtttctctgtgggccagagaac
agcgtgctggcccaggacaagctgctgctccaccacgacatgacgcagccactcaatcat
tacttcatcaactcgtcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctctctggctgccgttgcgtggagctagactgc
tggaaggggaaaccccctgacgaggagcccattatcacccatggcttcaccatgaccaca
gacatcttcttcaaagaagcaattgaggctattgcagaaagtgcctttaagacctccccc
tatcccatcatcctgtcttttgagaaccatgtggactcaccccgccagcaggctaagatg
gctgagtattgccggacgatctttggggatatgctgctcacagagcccctggaaaagttc
ccactaaaaccaggtgtccccctgcccagccctgaggacctcaggggcaagatcctcatc
aagaacaagaagaaccagttttctggccccacctcctccagtaaggatactggtggggag
gctgagggcagcagcccacccagtgcccctgcaggtgagggcacagtgtgggctggcgag
gaagggactgagctggaggaggaggaggtggaagaggaagaggaggaggagtcaggaaac
ctggatgaagaagagattaagaagatgcagtcggatgagggcacagcgggcctggaagtg
acggcttatgaggagatgtccagcctagtcaattacatccagcccaccaagttcgtctcc
tttgagttctctgctcaaaagaaccgaagttatgtcatctcgtccttcacagagctcaag
gcatatgacctgctctccaaggcctcggtgcagtttgtggactacaacaagcgccagatg
agccgcatttaccccaagggaacccgcatggactcctccaactacatgccccagatgttc
tggaatgctggatgccagatggttgccctcaacttccagacgatggacttgcccatgcag
cagaacatggcagtgtttgagttcaatgggcagagcggctacctcctcaagcatgagttc
atgcgccggccggacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtg
gccaccaccctttccattacggtgatctctgggcagttcctgtcagaacgcagcgtgcgc
acctatgtggaagtggagctgtttggccttcctggggaccccaagaggcgctatcgaact
aagctgtcacccagtactaactccatcaatcctgtctggaaggaggagccctttgtcttt
gagaagatcttgatgcctgagctggcctccctcagagtggctgtgatggaggaaggcaac
aagtttcttggacaccgcatcatccccatcaatgccctaaattctgggtaccaccacctg
tgcctgcacagtgagagcaacatgcccctcaccatgcctgcgctcttcatattcctggag
atgaaggactacatacctggtgcttgggcagatctcactgtggccctcgccaaccccatt
aagttcttcagtgcccatgacacgaagtctgtgaagctcaaggaggccatgggaggtctg
cctgagaagcccttcccactggcgagtccagttgccagccaggtcaatggggcgttggcc
ccaacgagcaatgggtcaccagcagccagggccggggccagggaagaggctatgaaagaa
gctgcggagccgcggaccgccagcctggaggagctccgggagctaaagggcgtggtgaag
ctgcagcggcggcacgagaaggagctgcgagagttggagcggcgcggagcgcggcgctgg
gaggagctgctgcagcggggcgcggagcagctggcggagctcgggccaccgggcgtgggg
ggtgtcggggcctgcaagctcggtcccggcaagggctctcgcaagaagaggagcctgccc
cgcgaggagagcgccggagccgcgccgggcgagggccctgagggcgtggacgggcgcgtg
cgggagctgaaagacaggctggagctggagctgctgcggcagggcgaggagcagtacgag
tgcgttctgaagcgcaaggagcagcacgcggccgagcaaatctccaaaatgatggagctg
gccagagagaaacaggcggcagagctgaaggccctgaaggagacgtcggagaacgacacc
aaagagatgaagaaaaagctggagacaaagagactggagcggatccagggcatgaccaaa
gtcaccacagacaagatggcccaggagaggttgaagagagagattaacaactcccacatc
caggaagtagtgcaggtgatcaagcagatgacggagaacttggagaggcaccaggagaag
ctggaggagaagcaggcggcttgcctggaacagatacgggagatggaaaagcagttccag
aaggaggcgctggcagagtacgaggccaggatgaagggtctggaggcagaggtgaaggag
tcggtgagggcctgcctcaggacctgctttccctctgaggccaaggacaagcctgagagg
gcctgcgagtgccccccagagctgtgtgagcaggacccactcatagcaaaggcagatgcc
caggagagccgcctctga

KEGG   Pan paniscus (bonobo): 100969660
Entry
100969660         CDS       T02283                                 

Gene name
PLCB1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04062  Chemokine signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04310  Wnt signaling pathway
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04621  NOD-like receptor signaling pathway
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04742  Taste transduction
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04973  Carbohydrate digestion and absorption
pps05010  Alzheimer disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05163  Human cytomegalovirus infection
pps05200  Pathways in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100969660 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100969660 (PLCB1)
   04310 Wnt signaling pathway
    100969660 (PLCB1)
   04371 Apelin signaling pathway
    100969660 (PLCB1)
   04020 Calcium signaling pathway
    100969660 (PLCB1)
   04070 Phosphatidylinositol signaling system
    100969660 (PLCB1)
   04072 Phospholipase D signaling pathway
    100969660 (PLCB1)
   04071 Sphingolipid signaling pathway
    100969660 (PLCB1)
   04022 cGMP-PKG signaling pathway
    100969660 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100969660 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100969660 (PLCB1)
   04613 Neutrophil extracellular trap formation
    100969660 (PLCB1)
   04621 NOD-like receptor signaling pathway
    100969660 (PLCB1)
   04062 Chemokine signaling pathway
    100969660 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    100969660 (PLCB1)
   04922 Glucagon signaling pathway
    100969660 (PLCB1)
   04929 GnRH secretion
    100969660 (PLCB1)
   04912 GnRH signaling pathway
    100969660 (PLCB1)
   04915 Estrogen signaling pathway
    100969660 (PLCB1)
   04921 Oxytocin signaling pathway
    100969660 (PLCB1)
   04926 Relaxin signaling pathway
    100969660 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    100969660 (PLCB1)
   04918 Thyroid hormone synthesis
    100969660 (PLCB1)
   04919 Thyroid hormone signaling pathway
    100969660 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100969660 (PLCB1)
   04916 Melanogenesis
    100969660 (PLCB1)
   04924 Renin secretion
    100969660 (PLCB1)
   04925 Aldosterone synthesis and secretion
    100969660 (PLCB1)
   04927 Cortisol synthesis and secretion
    100969660 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100969660 (PLCB1)
   04270 Vascular smooth muscle contraction
    100969660 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    100969660 (PLCB1)
   04971 Gastric acid secretion
    100969660 (PLCB1)
   04972 Pancreatic secretion
    100969660 (PLCB1)
   04973 Carbohydrate digestion and absorption
    100969660 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100969660 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100969660 (PLCB1)
   04725 Cholinergic synapse
    100969660 (PLCB1)
   04728 Dopaminergic synapse
    100969660 (PLCB1)
   04726 Serotonergic synapse
    100969660 (PLCB1)
   04720 Long-term potentiation
    100969660 (PLCB1)
   04730 Long-term depression
    100969660 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    100969660 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    100969660 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    100969660 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100969660 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100969660 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100969660 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100969660 (PLCB1)
   05142 Chagas disease
    100969660 (PLCB1)
   05143 African trypanosomiasis
    100969660 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100969660 (PLCB1)
   05016 Huntington disease
    100969660 (PLCB1)
   05017 Spinocerebellar ataxia
    100969660 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100969660 (PLCB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100969660 (PLCB1)
   05415 Diabetic cardiomyopathy
    100969660 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100969660 (PLCB1)
   04934 Cushing syndrome
    100969660 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100969660 (PLCB1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100969660 (PLCB1)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100969660 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100969660 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PLC-beta_C PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 100969660
NCBI-ProteinID: XP_003821410
UniProt: A0A2R8ZNS9
Position
20
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcagaacaaggag
acagagctactggatctcagccttgtcaaagatgccagatgtgggagacatgccaaagct
cccaaggaccccaaattacgtgaacttttggatgtggggaacatcgggcgcctggagcag
cgcatgatcacagtggtgtatgggcctgacctcgtgaacatctcccatttgaatctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatatatcgcttgttttcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgc
cctcgaccggaaattgataacatcttttcagaatttggtgccaaaagcaaaccatatctt
accgttgatcagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaagtatgaaccc
aacaacagcctcgccagaaaaggacaaatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
cccctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggaacctgtcattacccatggcttc
accatgacaactgaaatatctttcaaggaagtgatagaagcaattgcggagtgtgcattt
aagacttcaccttttccaattctcctttcgtttgagaaccatgtggattccccaaagcag
caagccaagatggcggagtactgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccactggaatctggagttcctcttccaagccctatggatttaatgtat
aaaattttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagcggcaaaaag
aagctctcagaacaagcctccaacacctacagtgactcctccagcatgttcgagccctca
tccccaggagccggagaagctgatacggaaagtgacgacgacgacgatgatgatgactgt
aaaaaatcttcaatggatgaggggactgctggaagtgaggctatggccacagaagaaatg
tctaatctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaactcacc
aagtctccagtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagctcttctggaatgcaggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatggggatgtat
gaatacaacgggaagagtggctacagattgaagccagagttcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtggcaaacactttgtctgtt
aagattatttcaggtcagtttctttctgataagaaagttgggacttacgtggaagtggat
atgttcggtttgcctgtggatacaaggaggaaggcatttaagaccaaaacatcccaagga
aatgctgtgaatcctgtctgggaggaagaacctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaattcattggccaccgt
atcttgccagtgcaagccattcggccaggctatcactatatctgtctaaggaatgaaagg
aaccagcctctgacgctgcctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcatcgaagctttatcaaacccaatccgatatgtgaacctgatg
gaacagagagctaagcaattggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggagaaacaccatcagaggctccaagtgaagcgagaacgactccagca
gaaaatggggtgaatcacactacaaccctgacacccaagccaccctcccaggctctccac
agccagccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gtcttaacagaagtggaagcacagaccatcgaagaactaaagcaacagaaatcgtttgtg
aaacttcaaaagaaacactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactaccaagtataatgaaattcagaatgactacttg
agaaggagagcagctttggaaaagtccgccaaaaaggacagtaagaaaaaatcggaaccc
agcagccctgatcatggttcatcaacgattgagcaagacctcgctgccctggatgctgaa
atgacccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aagttgacggatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagtcagatggaagaggagaagacagagatgatccgg
tcatatatccaggaagtggtgcagtatatcaagaggctagaagaagcgcaaagtaaacgg
caagaaaaactcgtagagaaacacaaggaaatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgcccctcgag
attttggaattcgtgcaggaagccatgaaaggaaagatcagtgaagacagcaatcacggt
tctgcccctctctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggagctgggaggagacatcccaggaaaagaatttgatactcctctgtga

KEGG   Pan paniscus (bonobo): 100978643
Entry
100978643         CDS       T02283                                 

Gene name
PLCB4
Definition
(RefSeq) phospholipase C beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04062  Chemokine signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04310  Wnt signaling pathway
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04621  NOD-like receptor signaling pathway
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04742  Taste transduction
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04973  Carbohydrate digestion and absorption
pps05010  Alzheimer disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05163  Human cytomegalovirus infection
pps05200  Pathways in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100978643 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100978643 (PLCB4)
   04310 Wnt signaling pathway
    100978643 (PLCB4)
   04371 Apelin signaling pathway
    100978643 (PLCB4)
   04020 Calcium signaling pathway
    100978643 (PLCB4)
   04070 Phosphatidylinositol signaling system
    100978643 (PLCB4)
   04072 Phospholipase D signaling pathway
    100978643 (PLCB4)
   04071 Sphingolipid signaling pathway
    100978643 (PLCB4)
   04022 cGMP-PKG signaling pathway
    100978643 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100978643 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100978643 (PLCB4)
   04613 Neutrophil extracellular trap formation
    100978643 (PLCB4)
   04621 NOD-like receptor signaling pathway
    100978643 (PLCB4)
   04062 Chemokine signaling pathway
    100978643 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    100978643 (PLCB4)
   04922 Glucagon signaling pathway
    100978643 (PLCB4)
   04929 GnRH secretion
    100978643 (PLCB4)
   04912 GnRH signaling pathway
    100978643 (PLCB4)
   04915 Estrogen signaling pathway
    100978643 (PLCB4)
   04921 Oxytocin signaling pathway
    100978643 (PLCB4)
   04926 Relaxin signaling pathway
    100978643 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    100978643 (PLCB4)
   04918 Thyroid hormone synthesis
    100978643 (PLCB4)
   04919 Thyroid hormone signaling pathway
    100978643 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    100978643 (PLCB4)
   04916 Melanogenesis
    100978643 (PLCB4)
   04924 Renin secretion
    100978643 (PLCB4)
   04925 Aldosterone synthesis and secretion
    100978643 (PLCB4)
   04927 Cortisol synthesis and secretion
    100978643 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100978643 (PLCB4)
   04270 Vascular smooth muscle contraction
    100978643 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    100978643 (PLCB4)
   04971 Gastric acid secretion
    100978643 (PLCB4)
   04972 Pancreatic secretion
    100978643 (PLCB4)
   04973 Carbohydrate digestion and absorption
    100978643 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100978643 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100978643 (PLCB4)
   04725 Cholinergic synapse
    100978643 (PLCB4)
   04728 Dopaminergic synapse
    100978643 (PLCB4)
   04726 Serotonergic synapse
    100978643 (PLCB4)
   04720 Long-term potentiation
    100978643 (PLCB4)
   04730 Long-term depression
    100978643 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    100978643 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    100978643 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    100978643 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100978643 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100978643 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100978643 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100978643 (PLCB4)
   05142 Chagas disease
    100978643 (PLCB4)
   05143 African trypanosomiasis
    100978643 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100978643 (PLCB4)
   05016 Huntington disease
    100978643 (PLCB4)
   05017 Spinocerebellar ataxia
    100978643 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    100978643 (PLCB4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100978643 (PLCB4)
   05415 Diabetic cardiomyopathy
    100978643 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100978643 (PLCB4)
   04934 Cushing syndrome
    100978643 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100978643 (PLCB4)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100978643 (PLCB4)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100978643 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100978643 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_6 EF-hand_7
Other DBs
NCBI-GeneID: 100978643
NCBI-ProteinID: XP_003810605
UniProt: A0A2R8ZM50
Position
20
AA seq 1187 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPSCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPVAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRSM
MEAGESASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKASD
DLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQ
SSSELRPTTTAALASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
NT seq 3564 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagttccttcctttttgcaagaagga
gcagtttttgacagatacgaagaggaatcctttgtgtttgaacccagctgcctcttcaaa
gtggatgagtttggcttctttctgacatggaaaagtgaaggcaaggaaggacaggtgcta
gaatgctccctcatcaacagtattcggtcgggagccataccaaaggatcccaaaatcttg
gctgctcttgaagctgttggaaaatcagaaaatgatctggaagggcggatagtttgtgtc
tgcagtggcacagatctagtgaacattagttttacctacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggcctgagatcaatcatacacaacttcagggccaacaac
gtcagtccaatgacatgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccagttaggagtattactagaacatttgcatcgggaaaaacagaaaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cccgtggcattttcttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaagatcttttcaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgattgaatgaaattttattt
ccattttatgatgccaaaagggcaatgcagatcattgagatgtatgaacctgacgaagat
ttgaagaaaaaaggccttatatcaagtgatgggttttgcagatatctgatgtcagatgaa
aacgccccagtcttcctagatcgtttagaactttaccaagaaatggaccatcctctggct
cactacttcatcagttcttcccataacacttatctcactggcagacagttcggcgggaag
tcttcggtagaaatgtacagacaggttctcctggctggttgcagatgtgttgaacttgac
tgctgggatggaaaaggtgaagaccaagaaccaataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgtaattcaagccatcaaggaaactgcatttgtcacatca
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcacat
ccacttgaaccaggcagggctttgccatcccccaatgacctcaaaagaaaaatactcata
aaaaacaagcggctgaaacctgaagttgaaaaaaaacagctggaagctttgagaagcatg
atggaagctggagaatctgcctccccagcaaacatcttagaggacgataatgaagaggaa
atcgaaagtgctgaccaagaggaggaagctcaccctgaattcaaatttggaaatgaactt
tctgctgatgacttgggtcacaaggaagctgttgcaaatagcgtcaagaaggcttcagat
gaccttgaacatgaaaacaacaaaaagggcctggtcactgtagaagatgagcaggcgtgg
atggcatcttataaatatgtaggtgctaccactaatatccatccatatttgtccacaatg
atcaactacgcccagcctgtaaagtttcaaggtttccatgtggcagaagaacgcaatatt
cattataacatgtcgtcttttaatgaatcagtcggtcttggctacttgaagacacatgca
attgaatttgtcaattataacaaacggcaaatgagtcgcatttaccccaagggaggccga
gtcgattccagtaattacatgcctcagattttctggaacgctggctgccagatggtttcg
ctgaactatcaaaccccagatttagcgatgcaattgaatcagggaaaatttgagtataat
ggatcgtgcgggtaccttctcaaaccagatttcatgaggcggcctgatcgaacatttgac
cccttctctgaaactcctgttgatggtgttattgcagccacttgctcagtgcaggttata
tcaggtcaattcttatcagataagaaaattggcacctacgtagaggtggatatgtatggg
ttgcccactgacaccatacgtaaggaattccgaactcgcatggttatgaataatggactc
aatccagtttacaatgaagagtcatttgtatttcggaaggtgatcctgccagacctggct
gtcttgagaatagctgtgtatgatgataacaacaagctgattggccagaggatcctcccg
cttgatggcctccaagccggatatcgacacatttcccttcgaaatgagggaaataaacca
ttatcactaccaacaattttctgcaatattgttcttaaaacatatgtgcctgatggattt
ggagatatcgtggatgctttatcagatccaaagaaatttctctcaattacagaaaagaga
gcagaccaaatgagagctatgggcattgaaactagtgacatagccgacgtgcccagtgac
acttccaaaaatgacaagaaaggaaaggccaacaccgccaaagcaaatgtgacccctcag
agtagctctgagctcagaccaaccaccacggctgccctggcctctggtgtggaagccaag
aaaggtattgaacttatccctcaagtaaggatagaagacttgaagcagatgaaggcttac
ttgaagcatttaaagaaacagcagaaggagctaaattctttaaagaagaaacatgcaaag
gaacacagtaccatgcagaagttacactgcacgcaagttgacaaaattgtggcacagtat
gacaaagagaagtcgactcatgagaaaatcctagagaaggcaatgaagaagaagggggga
agtaattgtctcgaaatgaaaaaagaaacagaaatcaaaattcagacgctgacatcagat
cacaaatctaaggtcaaagagattgtagcacagcacacaaaggaatggtcagaaatgatc
aatacccacagtgctgaggagcaagaaatccgagacctgcacctcagccagcagtgtgag
ctgctgaaaaagctactcatcaatgcccacgagcagcaaacccagcagctgaaactgtcc
catgacagggaaagcaaggaaatgcgagcacaccaggctaagatttctatggaaaatagc
aaagccatcagccaagataaatctatcaagaataaagcagaacgggaaaggcgagtcagg
gagttaaacagcagcaacactaaaaagtttctggaagaaagaaagagacttgccatgaag
cagtccaaagaaatggatcagttgaaaaaagtccagcttgaacatctagaattcctagag
aaacagaatgagcaggcgaaggagatgcagcagatggtgaaattggaagccgagatggac
cgcagaccagcaacagtagtatga

KEGG   Pan paniscus (bonobo): 100987524
Entry
100987524         CDS       T02283                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04062  Chemokine signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04310  Wnt signaling pathway
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04621  NOD-like receptor signaling pathway
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04742  Taste transduction
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04973  Carbohydrate digestion and absorption
pps05010  Alzheimer disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05163  Human cytomegalovirus infection
pps05200  Pathways in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100987524 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100987524 (PLCB3)
   04310 Wnt signaling pathway
    100987524 (PLCB3)
   04371 Apelin signaling pathway
    100987524 (PLCB3)
   04020 Calcium signaling pathway
    100987524 (PLCB3)
   04070 Phosphatidylinositol signaling system
    100987524 (PLCB3)
   04072 Phospholipase D signaling pathway
    100987524 (PLCB3)
   04071 Sphingolipid signaling pathway
    100987524 (PLCB3)
   04022 cGMP-PKG signaling pathway
    100987524 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100987524 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100987524 (PLCB3)
   04613 Neutrophil extracellular trap formation
    100987524 (PLCB3)
   04621 NOD-like receptor signaling pathway
    100987524 (PLCB3)
   04062 Chemokine signaling pathway
    100987524 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    100987524 (PLCB3)
   04922 Glucagon signaling pathway
    100987524 (PLCB3)
   04929 GnRH secretion
    100987524 (PLCB3)
   04912 GnRH signaling pathway
    100987524 (PLCB3)
   04915 Estrogen signaling pathway
    100987524 (PLCB3)
   04921 Oxytocin signaling pathway
    100987524 (PLCB3)
   04926 Relaxin signaling pathway
    100987524 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    100987524 (PLCB3)
   04918 Thyroid hormone synthesis
    100987524 (PLCB3)
   04919 Thyroid hormone signaling pathway
    100987524 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    100987524 (PLCB3)
   04916 Melanogenesis
    100987524 (PLCB3)
   04924 Renin secretion
    100987524 (PLCB3)
   04925 Aldosterone synthesis and secretion
    100987524 (PLCB3)
   04927 Cortisol synthesis and secretion
    100987524 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100987524 (PLCB3)
   04270 Vascular smooth muscle contraction
    100987524 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    100987524 (PLCB3)
   04971 Gastric acid secretion
    100987524 (PLCB3)
   04972 Pancreatic secretion
    100987524 (PLCB3)
   04973 Carbohydrate digestion and absorption
    100987524 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100987524 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100987524 (PLCB3)
   04725 Cholinergic synapse
    100987524 (PLCB3)
   04728 Dopaminergic synapse
    100987524 (PLCB3)
   04726 Serotonergic synapse
    100987524 (PLCB3)
   04720 Long-term potentiation
    100987524 (PLCB3)
   04730 Long-term depression
    100987524 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    100987524 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    100987524 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    100987524 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100987524 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100987524 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100987524 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100987524 (PLCB3)
   05142 Chagas disease
    100987524 (PLCB3)
   05143 African trypanosomiasis
    100987524 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100987524 (PLCB3)
   05016 Huntington disease
    100987524 (PLCB3)
   05017 Spinocerebellar ataxia
    100987524 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    100987524 (PLCB3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100987524 (PLCB3)
   05415 Diabetic cardiomyopathy
    100987524 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100987524 (PLCB3)
   04934 Cushing syndrome
    100987524 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100987524 (PLCB3)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100987524 (PLCB3)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100987524 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100987524 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 100987524
NCBI-ProteinID: XP_003828610
UniProt: A0A2R9CAD8
Position
11
AA seq 1234 aa
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDS
TGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGD
EGLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQL
GSQPSSNPTPSPLDASPRRPPGPTTSPTSTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLRSRQERDVRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
DGPLVACASNGHAPGSSGHLSGADSESQEENTQL
NT seq 3705 nt   +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtgaccctgcgtgtggaccccaatggcttcttcttgtactggacgggccccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccggtacgcccgcctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccagacccggtgaacacagtgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtctgaggagctattcaagctggctatg
aacatcctggctcagaacgcctcccggaacaccttcctgcgcaaagcatacacgaaactg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcgctggaatcctgtggcctcaaattcaaccggagt
gagtccatccggcccgatgagttttccttggaaatctttgagcgattcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaagccatac
ctgacgctggagcagctcatggacttcatcaaccagaagcaacgtgacccgagactcaac
gaagtgctgtacccacccctgcggccctcccaggcccggctgctcatcgaaaagtatgag
cccaaccagcagtttctggagcgagaccagatgtccatggagggctttagccgctacctg
ggaggcgaggagaatggcatcctgcccctggaagccctggatctgagcacggacatgacc
cagccactgagtgcctacttcatcaactcctcgcataacacctatctcactgcggggcag
ctggctgggacctcgtcggtggagatgtaccgccaggcactgctatggggctgccgctgc
gtggagctggacgtgtggaagggacggccacccgaggaggaacccttcattacccacggc
ttcaccatgaccacggaggtgcctctgcgcgacgtgctggaggccattgccgagactgcc
ttcaagacgtcgccctaccccgtcatcctctccttcgagaaccatgtggactcggcaaag
caacaggcaaagatggctgagtactgccgctccatctttggagacgcgctactcatcgag
cctctggacaagtacccgctggccccaggcgttcccctgcccagcccccaggacctgatg
ggccgtatcctggtgaagaacaagaagcggcaccgacccagcgcaggtggcccagacagc
actgggcgcaagcggcccctggagcagagcaattctgccctgagcgagagctccgcggcc
accgagccctcctccccgcagttggggtctcccagctctgacagctgcccaggcctgagc
aatggggaggaggtagggcttgagaagcccagcctggagcctcagaagtctctgggcgac
gagggcctgaaccggggcccctatgttcttggacctgctgaccgtgaggatgaggaggaa
gatgaggaagaggaggaacagacagaccccaaaaagccaactacagatgagggcacagcc
agcagcgaggtgaatgccactgaggagatgtccacgcttgtcaactacatcgagcctgtc
aagttcaagtcctttgaggctgctcgaaagaggaacaaatgcttcgagatgtcgtccttt
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgcgtggactcctccaactacatg
ccccagctcttctggaacgtagggtgccagcttgttgcgctcaacttccagacccttgat
gtggcgatgcagctcaacgcgggcgtttttgagtacaacgggcgcagcgggtacctgctc
aagccggagttcatgcggcggccggacaagtccttcgaccccttcactgaggtcatcgtg
gatggcatcgtggccaatgccttgcgggtcaaggtgatctcagggcagttcctgtccgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccctgttgacacgcggcgc
aagtaccgcacccggacctctcaggggaactcgttcaaccccgtgtgggacgaagagccc
ttcgacttccccaaggtggtgctgcccacgctggcttcacttcgcatcgcagcctttgag
gaggggggtaaattcgtagggcaccggatcctgcctgtctctgccatccgctccggatac
cactacgtctgcctgcggaacgaggccaaccaaccgctgtgcctgccggccctgctcatc
tacactgaagcctcggactacattcctgacgaccaccaggactacgcggaggccctgatc
aaccccattaagcacgtcagcctgatggaccagagggcccggcagctggccgccctcatt
ggggagagtgaggctcaggctggccaagagacgtgccaggacacccagtctcagcagctg
gggtctcagccgtcctcaaaccccacccctagcccactggatgcctccccccgccggccc
cctggccccaccacctcccctaccagcacctccctcagcagcccagggcagcgcgatgat
ctcatcgccagcatcctctcagaggtggcccccaccccgctggatgagctccgaggtcac
aaggctctggtcaagctccggagccggcaagagcgagacgtgcgggagctgcgcaagaag
catcagcggaaggcagtcaccctcacccgccgcctgctggatggcctggctcaggcacag
gctgagggcaggtgccggctgcggccaggtgccctaggtggggccgctgatgtggaggac
acgaaggagggggaggacgaggcaaagcggtatcaggagttccagaacagacaggtgcag
agcctgctggagctgcgggaggcccaggtggacgcagaggcccagcggaggctggaacac
ctgagacaggctctgcagcggctcagggaggtcgtccttgatgcaaacacaactcagttc
aagaggctgaaagagatgaacgagagggagaagaaggagctgcagaagatcctggacaga
aagcgccataacagcatctcggaggccaagatgagggacaagcataagaaggaggcggaa
ctgacggagattaaccgtcggcacatcactgagtcagtcaactccatccgtcggctggag
gaggcccagaagcagcggcatgaccgtcttgtggctgggcagcagcaggtcctgcaacag
ctggcagaagaggagcccaagctgctggcccagctggcccaggagtgtcaggagcagcgg
gcgaggctcccccaggagatccgccggagcctgctgggcgagatgccggaggggctgggg
gacgggcctctggtggcctgtgccagcaacggtcacgcacccgggagcagcgggcacctg
tcgggcgctgactcggagagccaggaggagaacacgcagctctga

DBGET integrated database retrieval system