KEGG   Pan paniscus (bonobo): 100969442
Entry
100969442         CDS       T02283                                 

Gene name
FLT4
Definition
(RefSeq) fms related tyrosine kinase 4
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps05200  Pathways in cancer
pps05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100969442 (FLT4)
   04014 Ras signaling pathway
    100969442 (FLT4)
   04015 Rap1 signaling pathway
    100969442 (FLT4)
   04020 Calcium signaling pathway
    100969442 (FLT4)
   04151 PI3K-Akt signaling pathway
    100969442 (FLT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100969442 (FLT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100969442 (FLT4)
  09162 Cancer: specific types
   05224 Breast cancer
    100969442 (FLT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100969442 (FLT4)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100969442 (FLT4)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   100969442 (FLT4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Ig_2 Pkinase ig VEGFR-2_TMD V-set Ig_6 C1-set TCAD9 Haspin_kinase
Other DBs
NCBI-GeneID: 100969442
NCBI-ProteinID: XP_008955193
Position
5
AA seq 1262 aa
MWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLRDALYLQCETTWGDQ
DFLSNPFLVHITGNELYDIQLLPRKSLELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQA
ERGKWVPERRSQQTHTELSSILTIHNVSQHDLGSYVCEANNGIQRFRESTEVIVHENPFI
SVEWLKGPILEATAGDELVKLPVKLAAYPPPEFQWYKDGKALSGRHSPHALVLKEVTEAS
TGTYTLALWNSAAGLRRNISLELVVNVPPQIHEKEASSPSIYSRHSRQALTCTAYGVPLP
LSIQWHWRPWTPCKMFAQRSLRRRQQQDLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEG
KNKTVSKLVIQNANVSAMYKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLEGQP
VLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCKNVHLFATPLAASLEEVAPGARH
ATLSLSIPRVAPEHEGHYVCEVQDRRSHDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSD
SLEMQCLVAGAHAPSIVWYKDERLLEEKSGVDLADSNQKLSIQRVREEDAGRYLCSVCNA
KGCVNSSASVAVEGSEDKGSMEIVILVGTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYL
SIIMDPGEVPLEEQCEYLSYDASQWEFPRERLHLGRVLGYGAFGKVVEASAFGINKGSSC
DTVAVKMLKEGATASEHRALMSELKILIHIGNHLNVVNLLGACTKPKGVRGLRGAAGGRG
MEAPLRRTTGRPRASFVHPQEKSPEQRGRFRAMVELARLDRRRPGSSDRVLFARFSKNEG
GARRASPDQEAEDLWLSPLTMEDLVCYSFQVARGMEFLASRKCIHRDLAARNILLSESDV
VKICDFGLARDIYKDPDYVRKGSARLPLKWMAPESIFDKVYTTQSDVWSFGVLLWEIFSL
GASPYPGVQINEEFCQRLRDGTRMRAPELATPAIRRVMLNCWSGDPKARPAFSELVEILG
DLLQGRGLQEEEEVCTVPRSSQSSEEGSFSQESTMALHIAQADAEDSPPSLQRHSLAARY
YNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYKGSVDNQTDSGMVLASEEFEQIDSR
HRQESGFSCKGPGQNVAVTRAHPDSQGRRRRPERGARGGQVFYNSEYGELPEPSEEDHCS
PSASQLGRAGLQAQGSRNSITTTGQGHAPAAPAPPPEIQMSFSSASAGAGPGASTSMGMS
LW
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgtgggtgccctgtctggtgtccatccccggcctcaatgtcacgctgcgctcgcaaagc
tcggtgctgtggccagatgggcaggaggtggtgtgggacgaccggcggggcatgctcgtg
tccacgccactgctgcgtgatgctctgtacctgcagtgcgagaccacctggggggaccag
gacttcctttccaaccccttcctggtgcacatcacaggcaacgagctctatgacatccag
ctgttgcccaggaagtcgctggagctgctggtaggggagaagctggtcctgaactgcacc
gtgtgggctgagttcaactcaggtgtcacctttgactgggactacccagggaagcaggca
gagcggggtaagtgggtgcctgagcgacgctcccagcagacccacacagaactctccagc
atcctgaccatccacaacgtcagccagcacgacctgggctcgtatgtgtgcgaggccaac
aacggcatccagcgatttcgggagagcaccgaggtcattgtgcatgaaaatcccttcatc
agtgtcgagtggctcaaaggacccattctggaggccacggcaggagacgagctggtgaag
ctgcccgtgaagctggcggcgtaccccccgcccgagttccagtggtacaaggatggaaag
gcactgtccgggcgccacagtccacatgccctggtgctcaaggaggtgacagaggccagc
acaggaacctacaccctcgccttgtggaactccgctgctggcctgaggcgcaacatcagc
ctggagctggtggtgaatgtgcccccccagatacacgagaaggaggcttcctcccccagc
atctactcgcgtcacagccgccaggccctcacctgcacggcctacggggtgcccctgcct
ctcagcatccagtggcactggcggccctggacaccctgcaagatgtttgcccagcgtagt
ctccggcggcggcagcagcaagacctcatgccacagtgccgtgactggagggcggtgacc
acgcaggatgccgtgaaccccatcgagagcctggacacctggaccgagtttgtggaggga
aagaataagactgtgagcaagctcgtgatccagaatgccaacgtgtccgccatgtacaag
tgtgtcgtctccaacaaggtgggccaggatgagcggctcatctacttctatgtgaccacc
atccccgacggcttcaccatcgaatccaagccatccgaggagctactagagggccagccc
gtgctcctgagctgccaagccgacagctacaagtacgagcatctgcgctggtaccgcctc
aacctgtccacgctgcacgatgcgcacgggaacccgcttctgctcgactgcaagaacgtg
catctgttcgccacccctctggccgccagcctggaggaggtggcacctggggcgcgccac
gccacgctcagcctgagtatcccccgcgtcgcgcccgagcacgagggccactatgtgtgc
gaagtgcaagaccggcgcagccatgacaagcactgccacaagaagtacctgtcggtgcag
gccctggaagcccctcggctcacgcagaacttgaccgacctcctggtgaacgtgagcgac
tcgctggagatgcagtgcttggtggccggagcgcacgcgcccagcatcgtgtggtacaaa
gacgagaggctgctggaggaaaagtcgggagtcgacttggcggactccaaccagaagctg
agcatccagcgcgtgcgcgaggaggatgcgggacgctatctgtgcagcgtgtgcaacgcc
aagggctgcgtcaactcctccgccagcgtggccgtggaaggctccgaggataagggcagc
atggagatcgtgatccttgtcggtaccggcgtcatcgctgtcttcttctgggtcctcctc
ctcctcatcttctgtaacatgaggaggccggcccacgcagacatcaagacgggctacctg
tccatcatcatggaccccggggaggtgcctctggaggagcaatgcgaatacctgtcctac
gatgccagccagtgggaattcccccgagagcggctgcacctggggagagtgcttggctac
ggcgccttcgggaaggtggtggaagcctccgctttcggcatcaacaagggcagcagctgt
gacaccgtggccgtgaaaatgctgaaagagggcgccacagccagcgagcaccgcgcgctg
atgtcggagctcaagatcctaattcacatcggtaaccacctcaacgtggtcaacctcctc
ggggcgtgcaccaagccgaagggagtgcgcggcctgcggggcgcggcgggcggccgggga
atggaggcgcctctgcggcggacgaccgggcgccctcgagccagcttcgtgcatccgcag
gagaagtctcccgagcagcgcggacgcttccgcgccatggtggagctcgccaggctggat
cggaggaggccagggagcagcgacagggtcctcttcgcacggttctcgaagaacgagggc
ggagcgaggcgggcttctccagaccaggaagctgaggacctgtggctgagcccgctgacc
atggaagatcttgtctgctacagcttccaggtggccagagggatggagttcctggcttcc
cgaaagtgcatccacagagacctggctgctcggaacattctgctgtcggaaagcgacgtg
gtgaagatctgtgactttggccttgcccgggacatctacaaagaccctgactacgtccgc
aagggcagtgcccggctgcccctgaagtggatggcccctgaaagcatcttcgacaaggtg
tacaccacgcagagtgacgtgtggtcctttggggtgcttctctgggagatcttctctctg
ggggcctccccgtaccctggggtgcagatcaatgaggagttctgccagcggctgagagac
ggcacgaggatgagggccccggagctggccactcccgccatacgccgcgtcatgctgaac
tgctggtccggagaccccaaggcgagacctgcattctcggagctggtggagatcctgggg
gacctgctccagggcaggggcctgcaagaggaagaggaggtctgcacagtcccgcgcagc
tctcagagctcagaagagggcagcttctcgcaggagtccaccatggccctacacatcgcc
caggctgacgctgaggacagcccgccaagcctgcagcgccacagcctggccgccaggtat
tacaactgggtgtcctttcccgggtgcctggccagaggggctgagacccgtggctcctcc
aggatgaagacatttgaggaattccccatgaccccaacgacctacaaaggctctgtggac
aaccagacagacagtgggatggtgctggcctcggaggagtttgagcagatagacagcagg
catagacaagaaagcggcttcagctgtaaaggacctggccagaatgtggctgtgaccagg
gcacaccctgactcccaagggaggcggcggcggcctgagcggggggcccgaggaggccag
gtgttttacaacagcgagtatggggagctgccggagccaagcgaggaggaccactgctcc
ccgtcggcttcccagctaggaagagcaggactccaggcccaaggctcccggaattccatc
accacgactggccagggccacgctccagctgccccggcccctccccctgagattcagatg
tcatttagttcagcatccgcaggtgctggtcccggggccagcacttccatgggaatgtct
ctttggtga

KEGG   Pan paniscus (bonobo): 100974494
Entry
100974494         CDS       T02283                                 

Gene name
ERBB3
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04020  Calcium signaling pathway
pps04151  PI3K-Akt signaling pathway
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100974494 (ERBB3)
   04012 ErbB signaling pathway
    100974494 (ERBB3)
   04020 Calcium signaling pathway
    100974494 (ERBB3)
   04151 PI3K-Akt signaling pathway
    100974494 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100974494 (ERBB3)
   05205 Proteoglycans in cancer
    100974494 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100974494 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100974494 (ERBB3)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100974494 (ERBB3)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100974494 (ERBB3)
SSDB
Motif
Pfam: Recep_L_domain PK_Tyr_Ser-Thr GF_recep_IV Furin-like Pkinase Kinase-like
Other DBs
NCBI-GeneID: 100974494
NCBI-ProteinID: XP_014202598
Position
12
AA seq 1330 aa
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGQC
IWMPXLPSLYRCGPPRPAMECILFYVSTSYILSPGWMIDENIRPTFKELANEFTRMARDP
PRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNLATTTLGSALS
LPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPHPVSLHPMPRGCL
ASESSEGHVTGSETELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLE
EEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYMNRRRRHSPPHPP
RPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPIPIMPTAGTTPDEDYEYMNRQRDGGGP
GGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSR
LFPKANAQRT
NT seq 3993 nt   +upstreamnt  +downstreamnt
atgagggcgaacgacgctctgcaggtgctgggcttgcttttcagcctggcccggggctcc
gaggtgggcaactctcaggcagtgtgtcctgggactctgaatggcctgagtgtgaccggc
gatgctgagaaccaataccagacactgtacaagctctacgagaggtgtgaggtggtgatg
gggaaccttgagattgtgctcacgggacacaatgccgacctctccttcctgcagtggatt
cgagaagtgacaggctatgtcctcgtggccatgaatgaattctctactctaccattgccc
aacctccgcgtggtgcgagggacccaggtctacgatgggaagtttgccatcttcgtcatg
ttgaactataacaccaactccagccacgctctgcgccagctccgcttgactcagctcacc
gagattctgtcagggggtgtttatattgagaagaacgataagctttgtcacatggacaca
attgactggagggacatcgtgagggaccgagatgctgagatagtggtgaaggacaatggc
agaagctgtccgccctgtcatgaggtttgcaaggggcgatgctggggtcctggatcagaa
gactgccagacattgaccaagaccatctgtgctcctcagtgtaatggtcactgctttggg
cccaaccccaaccagtgctgccatgatgagtgtgccgggggctgctcaggccctcaggac
acagactgctttgcctgccggcacttcaatgacagtggagcctgtgtacctcgctgtcca
cagcctcttgtctacaacaagctaactttccagctggaacccaatccccacaccaagtat
cagtatggaggagtttgtgtagccagctgtccccataactttgtggtggatcaaacatcc
tgtgtcagggcctgtcctcctgacaagatggaagtagataaaaatgggctcaagatgtgt
gagccttgtgggggactatgtcccaaagcctgtgagggaacaggctctgggagccgcttc
cagactgtggactcgagcaacattgatggatttgtgaactgcaccaagatcctgggcaac
ctggactttctgatcaccggcctcaatggagacccctggcacaagatccctgccctggac
ccagagaagctcaatgtcttccggacagtacgggagatcacaggttacctgaacatccag
tcctggccgccccacatgcacaacttcagtgttttttccaatttgacaaccattggaggc
agaagcctctacaaccggggcttctcattgttgatcatgaagaacttgaatgtcacatct
ctgggcttccgatccctgaaggaaattagtgctgggcgtatctatataagtgccaatagg
cagctctgctaccaccactctttgaactggaccaaggtgcttcgggggcctacggaagag
cgactagacatcaagcataatcggccgcgcagagactgcgtggcagagggcaaagtgtgt
gacccactgtgctcctctgggggatgctggggcccaggccctggtcagtgcttgtcctgt
cgaaattatagccgaggaggtgtctgtgtgacccactgcaactttctgaatggggagcct
cgagaatttgcccatgaggccgaatgcttctcctgccacccggaatgccaacccatggag
ggcactgccacatgcaatggctcgggctctgatacttgtgctcaatgtgcccattttcga
gatgggccccactgtgtgagcagctgcccccatggagtcctaggtgccaagggcccaatc
tacaagtacccagatgttcagaatgaatgtcggccctgccatgagaactgcacccagggg
tgtaaaggaccagagcttcaagactgtttaggacaaacactggtgctgatcggcaaaacc
catctgacaatggctttgacagtgatagcaggattggtagtgattttcatgatgctgggc
ggcacttttctctactggcgtgggcgccggattcagaataaaagggctatgaggcgatac
ttggaacggggtgagagcatagagcctctggaccccagtgagaaggctaacaaagtcttg
gccagaatcttcaaagagacagagctaaggaagcttaaagtgcttggctcgggtgtcttt
ggaactgtgcacaaaggagtgtggatccctgagggtgaatcaatcaagattccagtctgc
attaaagtcattgaggacaagagtggacggcagagttttcaagctgtgacagaccatatg
ctggccattggcagcctggaccatgcccacattgtaaggctgctgggactatgcccaggg
tcatctctgcagcttgtcactcaatatttgcctctgggttctctgctggatcatgtgaga
caacaccggggggcactggggccacagctgctgctcaactggggagtacaaattgccaag
ggaatgtactaccttgaggaacatggtatggtgcatagaaacctggctgcccgaaacgtg
ctactcaagtcacccagtcaggttcaggtggcagattttggtgtggctgacctgctgcct
cctgatgataagcagctgctatacagtgaggccaagactccaattaagtggatggccctt
gagagtatccactttgggaaatacacacaccagagtgatgtctggagctatggtcagtgc
atctggatgccctntctaccatcactgtataggtgtgggccaccgcgcccggccatggaa
tgtattctcttttatgtctctacctcctacatcttatctccaggttggatgattgatgag
aacattcgcccaacctttaaagaactagccaatgagttcaccaggatggcccgagatcca
ccacggtatctggtcataaagagagagagtgggcctggaatagcccctgggccagagccc
catggtctgacaaacaagaagctagaggaagtagagctggagccagaactagacctagac
ctagacttggaagcagaggaggacaacctggcaaccaccacactgggctccgccctcagc
ctaccagttggaacacttaatcggccacgtgggagccagagccttttaagtccatcatct
ggatacatgcccatgaaccagggtaatcttggggagtcttgccaggagtctgcagtttct
gggagcagtgaacggtgcccccatccagtctctctacacccaatgccacggggatgcctg
gcatcagagtcatcagaggggcatgtaacaggctctgagactgagctccaggagaaagtg
tcaatgtgtaggagccggagcaggagccggagcccacggccacgcggagatagcgcctac
cattcccagcgccacagtctgcttactcctgttaccccactctccccaccagggttagag
gaagaggatgtcaacggttatgtcatgccagatacacacctgaaaggtactccctcctcc
cgggaaggcaccctttcttcagtgggtctcagttctgtcctgggtactgaagaagaagat
gaagatgaggagtatgaatacatgaaccggaggagaaggcacagtccacctcatccccct
aggccaagttcccttgaggagctgggttatgagtacatggatgtggggtcagacctcagt
gcctctctgggcagcacacagagttgcccactccaccctatacccatcatgcctactgca
ggcacaactccagatgaagactatgaatatatgaatcggcaacgagatggaggtggtcct
gggggtgattatgcagccatgggggcctgcccagcctctgagcaagggtatgaagagatg
agagcttttcaggggcctggacatcaggccccccatgtccattatgcccgcctaaaaact
ctacgtagcttagaggctacagactctgcctttgataaccctgattactggcatagcaga
cttttccccaaggctaatgcccagagaacgtaa

KEGG   Pan paniscus (bonobo): 100974885
Entry
100974885         CDS       T02283                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04072  Phospholipase D signaling pathway
pps04144  Endocytosis
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04520  Adherens junction
pps04540  Gap junction
pps04630  JAK-STAT signaling pathway
pps04810  Regulation of actin cytoskeleton
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04921  Oxytocin signaling pathway
pps04926  Relaxin signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps05160  Hepatitis C
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100974885 (EGFR)
   04012 ErbB signaling pathway
    100974885 (EGFR)
   04014 Ras signaling pathway
    100974885 (EGFR)
   04015 Rap1 signaling pathway
    100974885 (EGFR)
   04630 JAK-STAT signaling pathway
    100974885 (EGFR)
   04066 HIF-1 signaling pathway
    100974885 (EGFR)
   04068 FoxO signaling pathway
    100974885 (EGFR)
   04020 Calcium signaling pathway
    100974885 (EGFR)
   04072 Phospholipase D signaling pathway
    100974885 (EGFR)
   04151 PI3K-Akt signaling pathway
    100974885 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100974885 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100974885 (EGFR)
   04520 Adherens junction
    100974885 (EGFR)
   04540 Gap junction
    100974885 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100974885 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100974885 (EGFR)
   04915 Estrogen signaling pathway
    100974885 (EGFR)
   04921 Oxytocin signaling pathway
    100974885 (EGFR)
   04926 Relaxin signaling pathway
    100974885 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100974885 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100974885 (EGFR)
   05206 MicroRNAs in cancer
    100974885 (EGFR)
   05205 Proteoglycans in cancer
    100974885 (EGFR)
   05230 Central carbon metabolism in cancer
    100974885 (EGFR)
   05231 Choline metabolism in cancer
    100974885 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100974885 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100974885 (EGFR)
   05212 Pancreatic cancer
    100974885 (EGFR)
   05225 Hepatocellular carcinoma
    100974885 (EGFR)
   05226 Gastric cancer
    100974885 (EGFR)
   05214 Glioma
    100974885 (EGFR)
   05218 Melanoma
    100974885 (EGFR)
   05219 Bladder cancer
    100974885 (EGFR)
   05215 Prostate cancer
    100974885 (EGFR)
   05213 Endometrial cancer
    100974885 (EGFR)
   05224 Breast cancer
    100974885 (EGFR)
   05223 Non-small cell lung cancer
    100974885 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100974885 (EGFR)
   05171 Coronavirus disease - COVID-19
    100974885 (EGFR)
   05163 Human cytomegalovirus infection
    100974885 (EGFR)
   05165 Human papillomavirus infection
    100974885 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100974885 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100974885 (EGFR)
   01522 Endocrine resistance
    100974885 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100974885 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100974885 (EGFR)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100974885 (EGFR)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100974885 (EGFR)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100974885 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100974885 (EGFR)
  Exosomal proteins of bladder cancer cells
   100974885 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT ABC1 Kdo
Other DBs
NCBI-GeneID: 100974885
NCBI-ProteinID: XP_008967087
UniProt: A0A2R9CMH6
Position
7
AA seq 1157 aa
MFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYY
ENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFL
SNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCH
NQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVK
KCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINA
TNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPEN
RTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYAN
TINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGR
ECVDKCNILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCIK
TCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGA
LLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH
VCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRL
VHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTH
QSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDA
DEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTMACIDRNGLQSCPIKEDSFLQRYSSDP
TGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPTPSRDPHYQDPHSTAV
GNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAE
NAEYLRVAPQSSEFIGA
NT seq 3474 nt   +upstreamnt  +downstreamnt
atgttcaataactgtgaggtggtccttgggaatttggaaattacctatgtgcagaggaat
tatgatctttccttcttaaagaccatccaggaggtggctggttatgtcctcattgccctc
aacacagtggagcggattcctttggaaaacctgcagatcatcagaggaaatatgtactat
gaaaattcctacgccttagcagtcttatctaactatgatgcaaataaaaccggactgaag
gagctgcccatgagaaatttacaggaaatcctgcatggcgccgtgcggttcagcaacaac
cctgccctgtgcaacgtggaaagcatccagtggcgggacatagtcagcagtgactttctc
agcaacatgtcaatggacttccagaaccacctgggcagctgccaaaagtgtgatccaagc
tgtcccaatgggagctgctggggtgcaggagaggagaactgccagaaactgaccaaaatc
atctgtgcccagcagtgctccgggcgctgccgcggcaagtcccccagtgactgctgccac
aaccagtgtgccgcaggctgcacgggcccccgggagagcgactgcctggtgtgccgcaaa
ttccgagatgaagccacgtgcaaggacacctgccccccactcatgctctacaaccccacc
acgtaccagatggatgtgaaccccgagggcaaatacagctttggtgccacctgcgtgaag
aagtgtccccgtaattatgtggtgacagatcacggctcgtgcgtccgagcctgtggggcc
gacagctatgagatggaggaagacggcgtccgcaagtgtaagaagtgcgaagggccttgc
cgcaaagtgtgtaacggaataggtattggtgaatttaaagacacactctccataaatgct
acgaatattaaacacttcaaaaactgcacctccatcagtggcgatctccacatcctgccg
gtggcatttaggggtgactccttcacacatactccgcctctggatccacaggaactggat
attctgaaaaccgtaaaggaaatcacagggtttttgctgattcaggcttggcctgaaaac
aggacggacctccatgcttttgagaacctagaaatcatacgcggcaggaccaagcaacat
ggtcagttttctcttgcggttgtcagcctgaacataacatccttgggattacgctccctc
aaggagataagtgatggagatgtgataatttcaggaaacaaaaatttgtgctatgcaaat
acaataaactggaaaaaactgtttgggacctccggtcagaaaacgaaaattataagcaac
agaggtgaaaacagctgcaaggccacaggccaggtctgccatgccttgtgctcccccgag
ggctgctggggcccggagcccagggactgcgtctcttgccggaatgtcagccgaggcagg
gaatgcgtggacaagtgcaacattctggagggcgagccaagggagtttgtggagaactct
gagtgcatacagtgccacccagagtgcctgcctcaggccatgaacatcacctgcacagga
cggggaccagacaactgtatccagtgtgcccactacattgacggcccccactgcatcaag
acctgcccggcaggagtcatgggagaaaacaacaccctggtctggaagtacgcagatgcc
ggccatgtgtgccacctgtgccatccaaactgcacctacggatgcactgggccaggtctt
gaaggctgtccaacgaatgggcctaagatcccttccatcgccactgggatggtgggggcc
ctcctcttgctgctggtggtggccctggggatcggcctcttcatgcgaaggcgccacatc
gttcggaagcgcacgctgcggaggctgctgcaggagagggagcttgtggagcctcttaca
cccagtggagaagctcccaaccaagctctcttgaggatcttgaaggaaactgaattcaaa
aagatcaaagtgctggggtccggtgcgttcggcacggtgtataagggactctggatccca
gaaggtgagaaagttaaaattcccgtcgctatcaaggaattaagagaagcaacgtctccg
aaagccaacaaggaaatcctcgatgaagcctacgtgatggccagcgtggacaacccccac
gtgtgccgcctgctgggcatctgcctcacctccaccgtgcagctcatcacgcagctcatg
cccttcggctgcctcctggactatgtccgggaacacaaagacaatattggctcccagtac
ctgctcaactggtgtgtgcagatcgcaaagggcatgaactacttggaggaccgtcgcttg
gtgcaccgcgacctggcagccaggaacgtactggtgaaaacaccgcagcatgtcaagatc
acagattttgggctggccaaactgctgggtgcagaagagaaagaatatcatgcagaagga
ggcaaagtgcctatcaagtggatggcattggaatcaattttacacagaatctatacccac
cagagtgatgtctggagctacggggtgaccgtttgggagttgatgacctttggatccaag
ccatatgacggaatccctgccagcgagatctcctccatcctggagaaaggagaacgcctc
cctcagccacccatatgtaccatcgatgtctacatgatcatggtcaagtgctggatgata
gacgcagatagtcgcccaaagttccgtgagttgatcatcgaattctccaaaatggcccga
gacccccagcgctaccttgtcattcagggggatgaaagaatgcatttgccaagccctaca
gattccaacttctaccgtgccctgatggatgaagaagacatggacgacgtggtggatgcc
gacgagtacctcatcccacagcagggcttcttcagcagcccctccacgtcacggactccc
ctcctgagctctctgagtgcaaccagcaacaattccactatggcttgcattgatagaaat
gggctgcaaagctgtcccatcaaggaagacagcttcttgcagcgatacagctcagacccc
acaggcgccttgactgaggacagcatagacgacaccttcctcccagtgcctgaatacata
aaccagtccgttcccaaaaggcccgctggctctgtgcagaatcctgtctatcacaatcag
cctctgaaccccacgcccagcagagacccacactaccaggacccccacagcactgcagtg
ggcaaccccgagtatctcaacactgtccagcccacctgtgtcaacagcacattcgacagc
cctgcccactgggcccagaaaggcagccaccaaattagcctggacaaccctgactaccag
caggacttctttcccaaggaagccaagccaaatggcatctttaagggctccacagctgaa
aatgcagaatacctaagggtagcgccacaaagcagtgaatttattggagcatga

KEGG   Pan paniscus (bonobo): 100975853
Entry
100975853         CDS       T02283                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04072  Phospholipase D signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04540  Gap junction
pps04630  JAK-STAT signaling pathway
pps04810  Regulation of actin cytoskeleton
pps05165  Human papillomavirus infection
pps05200  Pathways in cancer
pps05206  MicroRNAs in cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100975853 (PDGFRB)
   04014 Ras signaling pathway
    100975853 (PDGFRB)
   04015 Rap1 signaling pathway
    100975853 (PDGFRB)
   04630 JAK-STAT signaling pathway
    100975853 (PDGFRB)
   04020 Calcium signaling pathway
    100975853 (PDGFRB)
   04072 Phospholipase D signaling pathway
    100975853 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    100975853 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100975853 (PDGFRB)
   04540 Gap junction
    100975853 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100975853 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100975853 (PDGFRB)
   05206 MicroRNAs in cancer
    100975853 (PDGFRB)
   05230 Central carbon metabolism in cancer
    100975853 (PDGFRB)
   05231 Choline metabolism in cancer
    100975853 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    100975853 (PDGFRB)
   05218 Melanoma
    100975853 (PDGFRB)
   05215 Prostate cancer
    100975853 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100975853 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100975853 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100975853 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100975853 (PDGFRB)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100975853 (PDGFRB)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100975853 (PDGFRB)
CD molecules [BR:pps04090]
 Proteins
  100975853 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set TrmE_N TCAD9 Haspin_kinase
Other DBs
NCBI-GeneID: 100975853
NCBI-ProteinID: XP_008952698
Position
5
AA seq 1119 aa
MDTMRLLGAMPALALKGKLLLLPLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGS
APVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLY
IFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQR
GFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIV
IGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAXXXXXXXPSAELEDSG
TYTCNVTESVNDHQDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPT
VLWFKDNRTLGDSSAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQL
SFQLQINVPVRVLELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLG
NSSEEESQLETNVTYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHS
LPFKVVVISAILALVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQL
PYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQA
LMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDK
RRPPSAELYSNALPVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIE
SSNYMAPYDNYVPSAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDL
AARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVW
SFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEI
RPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSV
LYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQ
DEPEPEPQLELQVEPEPELEQLPDSGCPAPRAEAEDSFL
NT seq 3360 nt   +upstreamnt  +downstreamnt
atggacaccatgcggcttctgggtgcgatgccagctctggccctcaaaggcaagctgctg
ttgctgcccctcctgttactgctggaaccacagatctctcagggcctggtcgtcacaccc
ccggggccagagcttgtcctcaatgtctccagcaccttcgttctgacctgctcgggttca
gctccggtggtgtgggaacggatgtcccaggagcccccacaggaaatggccaaggcccag
gacggcaccttctccagcgtgctcacactgaccaacctcactgggctagacacgggagaa
tacttttgcacccacaatgactcccgtggactggagaccgatgagcggaaacggctctac
atctttgtgccagatcccaccgtgggcttcctccctaatgatgccgaggaactattcatc
tttctcacggaaataactgagatcaccattccatgccgagtaacagacccacagctggtg
gtgacactgcacgagaagaaaggggacgttgcactgcctgtcccctatgatcaccaacgt
ggcttttctggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagg
gaggtggattccgatgcctactatgtctacagactccaggtgtcatccatcaacgtctct
gtgaacgcagtgcagactgtggtccgccagggtgagaacatcaccctcatgtgcattgtg
atcgggaatgaggtggtcaacttcgagtggacatacccccgcaaagaaagtgggcggctg
gtggagccggtgactgacttcctcttggatatgccttaccacatccgctccatcctgcac
atccccagtgcnnnnnnnnnnnnnnnnnnnntccccagtgccgagttagaagactcgggg
acctacacctgcaacgtgacggagagtgtgaatgaccatcaggatgaaaaggccatcaac
atcaccgtggttgagagcggctacgtgcggctcctgggagaggtgggcacactacagttt
gctgagctgcatcggagccggacactgcaggtagtgttcgaggcctacccaccgcccact
gtcctgtggttcaaagacaaccgcaccctgggcgactccagcgctggcgaaatcgccctg
tccacgcgcaacgtgtcggagacccggtatgtgtcagagctgacactggttcgcgtgaag
gtggcagaggctggccactacaccatgcgggccttccatgaggatgctgaggtccagctc
tccttccagctacagatcaatgtccctgtccgagtgctggagctaagtgagagccaccct
gacagtggggaacagacagtccgctgtcgtggccggggcatgccccagccgaacatcatc
tggtctgcctgcagagacctcaaaaggtgtccacgcgagctgccgcccacgctgctgggg
aacagttccgaagaggagagccagctggagactaacgtgacgtactgggaggaggagcag
gagtttgaggtggtgagcacactgcgtctgcagcacgtggatcggccgctgtcggtgcgc
tgcacgctgcgcaacgctgtgggccaggacacgcaggaggtcatcgtggtgccacactcc
ttgccctttaaggtggtggtgatctcagccatcctggccctggtggtgctcaccatcatc
tcccttatcatcctcatcatgctttggcagaagaagccacgttacgagatccgatggaag
gtgattgagtctgtgagctctgacggccatgagtacatctacgtggaccccatgcagctg
ccctatgactccacgtgggagctgccgcgggaccagcttgtgctgggacgcaccctcggc
tctggggcctttgggcaggtggtggaggccacggctcatggcctgagccattctcaggcc
acgatgaaagtggccgtcaagatgcttaaatccacagcccgcagcagtgagaagcaagcc
cttatgtcggagctgaagatcatgagtcaccttgggccccacctgaacgtggtcaacctg
ttgggggcctgcaccaaaggaggacccatctatatcatcactgagtactgccgctacgga
gacctggtggactacctgcaccgcaacaaacataccttcctgcagcaccactccgacaag
cgccgcccgcccagcgcggagctctacagcaatgcactgcccgttgggctccccctgccc
agccatgtgtccttgaccggggagagcgacggtggctacatggacatgagcaaggacgag
tcggtggactatgtgcccatgctggacatgaaaggagacgtcaaatatgcagacatcgag
tcctccaactacatggccccttatgataactacgttccctctgcccctgagaggacctgc
cgggcaactttgatcaacgagtctccagtgctaagctacatggacctcgtgggcttcagc
taccaggtggccaatggcatggagtttctggcctccaagaactgcgtccacagagacctg
gcggctaggaacgtgctcatctgtgaaggcaagctggtcaagatctgtgactttggcctg
gctcgagacatcatgcgggactcgaattacatctccaaaggcagtacctttttgcctttg
aagtggatggctccggagagcatcttcaacagcctctacaccaccctgagtgacgtgtgg
tcctttgggatcctgctctgggagatcttcaccttgggtggcaccccttacccagagctg
cccatgaatgagcagttctacaatgccatcaaacggggttaccgcatggcccagcctgcc
catgcctccgacgagatctatgagatcatgcagaagtgctgggaagagaagtttgagatt
cggccccccttctcccagctggtgctgcttctcgagagactgttgggcgaaggttacaaa
aagaagtaccagcaggtggatgaggagtttctgaggagtgaccacccagccatccttcgg
tcccaggcccgcttgcctgggttccatggcctccgatctcccctggacaccagctccgtc
ctctatactgccgtgcagcccaatgagggtgacaacgactatatcatccccctgcctgac
cccaaacccgaggttgctgacgagggcccactggagggttcccccagcctagccagctcc
accctgaatgaagtcaacacctcctcaaccatctcctgtgacagcccgctggagccccag
gacgaaccagagccagagccccagcttgagctccaggtggagccggagccagagctggaa
cagttgccggattcggggtgccctgcgcctcgggcggaagcagaggatagcttcctgtag

KEGG   Pan paniscus (bonobo): 100976551
Entry
100976551         CDS       T02283                                 

Gene name
FGFR3
Definition
(RefSeq) fibroblast growth factor receptor 3
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04144  Endocytosis
pps04151  PI3K-Akt signaling pathway
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04810  Regulation of actin cytoskeleton
pps05200  Pathways in cancer
pps05206  MicroRNAs in cancer
pps05219  Bladder cancer
pps05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100976551 (FGFR3)
   04014 Ras signaling pathway
    100976551 (FGFR3)
   04015 Rap1 signaling pathway
    100976551 (FGFR3)
   04020 Calcium signaling pathway
    100976551 (FGFR3)
   04151 PI3K-Akt signaling pathway
    100976551 (FGFR3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100976551 (FGFR3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100976551 (FGFR3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100976551 (FGFR3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100976551 (FGFR3)
   05206 MicroRNAs in cancer
    100976551 (FGFR3)
   05230 Central carbon metabolism in cancer
    100976551 (FGFR3)
  09162 Cancer: specific types
   05219 Bladder cancer
    100976551 (FGFR3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100976551 (FGFR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100976551 (FGFR3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100976551 (FGFR3)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100976551 (FGFR3)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100976551 (FGFR3)
CD molecules [BR:pps04090]
 Proteins
  100976551 (FGFR3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set C2-set_2 ABC1 Pkinase_fungal TCAD9 DUF1533
Other DBs
NCBI-GeneID: 100976551
NCBI-ProteinID: XP_008963713
Position
4
AA seq 740 aa
MGPTVWVKDGAGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDA
PSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISW
LKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLER
SPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTV
LKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADE
AGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLKRQVTVSLE
SNASMNSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQV
VMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACT
QGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGME
YLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEAL
FDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMI
MRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDD
SVFAHDLLPPAPPSSGGSRT
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgggacccactgtctgggtcaaggatggcgcagggctggtgccctcggagcgtgtcctg
gtgggcccccagcggctgcaggtgctgaatgcctcccacgaggactccggggcctacagc
tgccggcagcggctcacgcagcgcgtactgtgccacttcagtgtgcgggtgacagacgct
ccatcctcgggagatgacgaagacggggaggacgaggctgaggacacaggtgtggacaca
ggggccccttactggacacggcccgagcggatggacaagaagctgctggccgtgccggcc
gccaacaccgtccgcttccgctgcccagccgccggcaaccccactccctccatctcctgg
ctgaagaacggcagggagttccgcggcgagcaccgcatcggaggcatcaagctgcggcat
cagcagtggagcctggtcatggaaagcgtggtgccctcggaccgcggcaactacacctgc
gtcgtggagaacaagtttggcagcatccggcagacgtacacgctggacgtgctggagcgc
tccccgcaccggcccatcctgcaggcggggctgccggccaaccagacggcggtgctgggc
agcgacgtggagttccactgcaaggtgtacagtgacgcacagccccacatccagtggctc
aagcacgtggaggtgaacggcagcaaggtgggcccggacggcacaccctacgttaccgtg
ctcaagacggcgggcgctaacaccaccgacaaggagctagaggttctctccttgcacaac
gtcacctttgaggacgccggggagtacacctgcctggcgggcaattctattgggttttct
catcactctgcgtggctggtggtgctgccagccgaggaggagctggtggaggctgacgag
gcgggcagtgtgtatgcaggcatcctcagctacggggtgggcttcttcctgttcatcctg
gtggtggcggctgtgacgctctgccgcctgcgcagcccccccaagaaaggcctgggctcc
cccaccgtgcacaagatctcccgcttcccgctcaagcgacaggtaacagtgtccctggag
tccaacgcatccatgaactccaacacaccactggtgcgcatcgcaaggctgtcctcaggg
gagggccccacgctggccaatgtctccgagctcgagctgcctgccgaccccaaatgggag
ctgtctcgggcccggctgaccctgggcaagccccttggggagggctgcttcggccaggtg
gtcatggcggaggccatcggcattgacaaggaccgggccgccaagcctgtcaccgtagcc
gtgaagatgctgaaagacgatgccactgacaaggacctgtcggacctggtgtctgagatg
gagatgatgaagatgatcgggaaacacaaaaacatcatcaacctgctgggcgcctgcacg
cagggcgggcccctgtacgtgctggtggagtacgcggccaagggtaacctgcgggagttc
ctgcgggcgcggcggcccccgggcctggactactccttcgacacctgcaagccgcccgag
gagcagctcaccttcaaggacctggtgtcctgtgcctaccaggtggcccggggcatggag
tacttggcctcccagaagtgcatccacagggacctggctgcccgcaatgtgctggtgacc
gaggacaacgtgatgaagatcgcagacttcgggctggcccgggacgtgcacaacctcgac
tactacaagaagacgaccaacggccggctgcccgtgaagtggatggcgcctgaggccttg
tttgaccgagtctacactcaccagagtgacgtctggtcctttggggtcctgctctgggag
atcttcacgctggggggctccccgtaccccggcatccctgtggaggagctcttcaagctg
ctgaaggagggccaccgcatggacaagcccgccaactgcacacacgacctgtacatgatc
atgcgggagtgctggcatgccgcgccctcccagaggcccaccttcaagcagctggtggag
gacctggaccgtgtccttaccgtgacgtccaccgacgagtacctggacctgtcggcgcct
ttcgagcagtactccccgggtggccaggacacccccagctccagctcctcaggggacgac
tccgtgtttgcccacgacctgctgcccccggccccacccagcagtgggggctcgcggacg
tga

KEGG   Pan paniscus (bonobo): 100977227
Entry
100977227         CDS       T02283                                 

Gene name
ERBB2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04020  Calcium signaling pathway
pps04066  HIF-1 signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04520  Adherens junction
pps04530  Tight junction
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05215  Prostate cancer
pps05219  Bladder cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100977227 (ERBB2)
   04012 ErbB signaling pathway
    100977227 (ERBB2)
   04066 HIF-1 signaling pathway
    100977227 (ERBB2)
   04020 Calcium signaling pathway
    100977227 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100977227 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100977227 (ERBB2)
   04520 Adherens junction
    100977227 (ERBB2)
   04530 Tight junction
    100977227 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100977227 (ERBB2)
   05206 MicroRNAs in cancer
    100977227 (ERBB2)
   05205 Proteoglycans in cancer
    100977227 (ERBB2)
   05230 Central carbon metabolism in cancer
    100977227 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100977227 (ERBB2)
   05226 Gastric cancer
    100977227 (ERBB2)
   05219 Bladder cancer
    100977227 (ERBB2)
   05215 Prostate cancer
    100977227 (ERBB2)
   05213 Endometrial cancer
    100977227 (ERBB2)
   05224 Breast cancer
    100977227 (ERBB2)
   05223 Non-small cell lung cancer
    100977227 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100977227 (ERBB2)
   01524 Platinum drug resistance
    100977227 (ERBB2)
   01522 Endocrine resistance
    100977227 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100977227 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100977227 (ERBB2)
   04090 CD molecules [BR:pps04090]
    100977227 (ERBB2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100977227 (ERBB2)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100977227 (ERBB2)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100977227 (ERBB2)
CD molecules [BR:pps04090]
 Proteins
  100977227 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 100977227
NCBI-ProteinID: XP_003831500
UniProt: A0A2R9C656
Position
17
AA seq 1255 aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLP
DLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARC
PSGVKPDLSYMPIWKFPDEEGTCQPCPINCTHSCVDLDDKGCPAEQRASPLTSIISAVVG
ILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEG
AGSDVFDGDVGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYV
NQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQ
GGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagttggcggccttgtgccgctgggggctcctcctcgccctcttgccccccggagcc
gcgagcacccaagtgtgcaccggcacagacatgaagctgcggctccctgccagtcctgag
acccacctggacatgctccgccacctctaccagggctgccaggtggtgcagggaaacctg
gaactcacctacctgcccaccaatgccagcctgtccttcctgcaggatatccaggaggtg
cagggctacgtgctcatcgctcacaaccaagtgaggcaggtcccactgcagaggctgcgg
attgtgcgaggcacccagctctttgaggacaactatgccctggccgtgctagacaatgga
gacccgctgaacaataccacccctgtcacaggggcctccccaggaggcctgcgggagctg
cagcttcgaagcctcacagagatcttgaaaggaggggtgttgatccagcggaacccccag
ctctgctaccaggacacgattttgtggaaggacatcttccacaagaacaaccagctggct
ctcacactgatagacaccaaccgctctcgggcctgccacccctgttctccgatgtgtaag
ggctcccgctgctggggagagagttctgaggattgtcagagcctgacgcgcactgtctgt
gccggtggctgtgcccgctgcaaggggccactgcccactgactgctgccatgagcagtgt
gctgccggctgcacgggccccaagcactctgactgcctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagccctggtcacctacaacacagacacgtttgag
tccatgcccaatcccgagggccggtatacattcggcgccagctgtgtgactgcctgtccc
tacaactacctttctacggacgtgggatcctgcaccctcgtctgccccctgcacaaccaa
gaggtgacagcagaggatggaacacagcggtgtgagaagtgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggagcacttgcgagaggtgagggcagttaccagtgccaat
atccaggagtttgctggctgcaagaagatctttgggagcctggcatttctgccggagagc
tttgatggggacccagcctccaacactgccccgctccagccagagcagctccaagtgttt
gagactctggaagagatcacaggttacctatacatctcagcatggccagacagcctgcct
gacctcagcgtcttccagaacctgcaagtaatccggggacgaattctacacaatggcgcc
tactcgctgaccctgcaagggctgggcatcagctggctggggctgcgctcgctgagggaa
ctgggcagtggactggccctcatccaccataacacccacctctgcttcgtgcacacggtg
ccctgggaccagctctttcggaacccgcaccaagctctgctccacactgccaaccggcca
gaggatgagtgtgtgggcgagggcctggcctgccaccagctgtgcgcccgagggcactgc
tggggtccagggcccacccagtgtgtcaactgcagccagttccttcggggccaggagtgc
gtggaggaatgccgagtactgcaggggctccccagggagtatgtgaatgccaggcactgt
ttgccgtgccaccctgagtgtcagccccagaatggctcagtgacctgttttggaccggag
gctgaccagtgtgtggcctgtgcccactataaggaccctcccttctgcgtggcccgctgc
cccagcggtgtgaaacctgacctctcctacatgcccatctggaagtttccagatgaggag
ggcacatgccagccttgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgccgagcagagagccagccctctgacgtccatcatctctgcggtggttggc
attctgctggtcgtggtcttgggggtggtctttgggatcctcatcaagcgacggcagcag
aagatccggaagtacacgatgcggagactgctgcaggaaacggagctggtggagccgctg
acacctagcggagcgatgcccaaccaggcgcagatgcggatcctgaaggagacggagctg
aggaaggtgaaggtgcttggatctggcgcttttggcacagtctacaagggcatctggatc
cctgatggggagaatgtgaaaattccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttagacgaagcatacgtgatggctggtgtgggctcccca
tatgtctcccgccttctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcttagaccatgtccgggaaaaccgcggacgcctgggctcccag
gacctgctgaactggtgtatgcagattgccaaggggatgagctacctggaggatgtgcgg
ctcgtacacagggacttggctgctcggaacgtgctggtcaagagtcccaaccatgtcaaa
attacagacttcgggctggctcggctgctggacattgatgagacagagtaccatgcagat
gggggcaaggtgcccatcaagtggatggcgctggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagttatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccctgacctgctggaaaaaggggagcgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccgagattccgggagttggtgtctgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggcccagccagtcccttg
gacagcaccttctaccgctcactgctggaggacgatgacatgggggacctggtggatgct
gaggagtatctggtaccccagcagggcttcttctgtccagaccctgccccgggcgctggg
ggcatggtccaccacaggcaccgcagctcatctaccaggagtggcggtggggacctgaca
ctagggctggagccctctgaagaggaggcccccaggtctccactggcaccctccgaaggg
gctggctccgatgtatttgatggtgacgtgggaatgggggcagccaaggggctgcaaagc
ctccccacacatgaccccagccctctacagcggtacagtgaggaccccacagtacccctg
ccctctgagactgatggctacgttgcccccctgacctgcagcccccagcccgaatatgtg
aaccagccagatgttcggccccagcccccttcgccccgagagggccctctgcctgctgcc
cgacctgctggtgccactctggaaaggcccaagactctctccccagggaagaatggggtc
gtcaaagacgtttttgcctttgggggtgccgtggagaaccccgagtacttgacaccccag
ggaggagctgcccctcagccccaccctcctcctgccttcagcccagccttcgacaacctc
tattactgggaccaggacccaccagagcggggggctccacccagcaccttcaaagggaca
cctacggcagagaacccagagtacctgggtctggacgtgccagtgtga

KEGG   Pan paniscus (bonobo): 100977352
Entry
100977352         CDS       T02283                                 

Gene name
FLT1
Definition
(RefSeq) fms related tyrosine kinase 1
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04066  HIF-1 signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps05202  Transcriptional misregulation in cancer
pps05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100977352 (FLT1)
   04014 Ras signaling pathway
    100977352 (FLT1)
   04015 Rap1 signaling pathway
    100977352 (FLT1)
   04066 HIF-1 signaling pathway
    100977352 (FLT1)
   04020 Calcium signaling pathway
    100977352 (FLT1)
   04151 PI3K-Akt signaling pathway
    100977352 (FLT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100977352 (FLT1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100977352 (FLT1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100977352 (FLT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100977352 (FLT1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100977352 (FLT1)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   100977352 (FLT1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set ig Pkinase Ig_2 V-set VEGFR-2_TMD Ig_6 Ig_4 C1-set Ig_5 Haspin_kinase Adeno_E3_CR1 TCAD9 Marek_A
Other DBs
NCBI-GeneID: 100977352
NCBI-ProteinID: XP_003818375
Position
13
AA seq 1338 aa
MVSYWDTGVLLCALLSCLILTGSSSGSKLKDPELSLKGTQHVMQAGQTLHLQCRGEAAHK
WSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFIEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD
GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
MQNEDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
DFCSNNEESFILDADSNMGNRIESITQRMAVIEGKNKTASTLVVADSRISGIYICIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTILNVSLEDSGTYACRARNVYTGEEILQKKEITIRDQEA
PYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER
VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI
RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV
TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISA
PKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIAC
CSPPPDYNSVVLYSTPPI
NT seq 4017 nt   +upstreamnt  +downstreamnt
atggtcagctactgggacaccggggtcctgctgtgcgcgctgctcagctgtctgattctc
acaggatctagttcaggttcaaaattaaaagatcctgaactgagtttaaaaggcacccag
cacgtcatgcaagcaggccagacactgcatctccaatgcaggggggaagcagcccataaa
tggtctttgcctgaaatggtgagtaaggaaagcgaaaggctgagcataactaaatctgcc
tgtggaagaaatggcaaacaattctgcagtactttaaccttgaacacagctcaagcaaac
cacactggcttctacagctgcaaatatctagctgtacctacttcaaagaagaaggaaaca
gaatctgcaatctatatatttattagtgatacaggtagacctttcatagagatgtacagt
gaaatccccgaaattatacacatgactgaaggaagggagctcgtcattccctgccgggtt
acgtcacctaacatcactgttactttaaaaaagtttccacttgacactttaatccctgat
ggaaaacgcataatctgggacagtagaaagggcttcatcatatcaaatgcaacgtacaaa
gaaatagggcttctgacctgtgaagcaacagtcaatgggcatttgtataagacaaactat
ctcacacatcgacaaaccaatacaatcatagatgtccaaataagcacaccacgcccagtc
aaattacttagaggccatactcttgtcctcaattgtactgctaccactcccttgaacacg
agagttcaaatgacctggagttaccctgatgaaaaaaataagagagcctccgtaaggcga
cgaattgaccaaagcaattcccatgccaacatattctacagtgttcttactattgacaaa
atgcagaacgaagacaaaggactttatacttgtcgtgtaaggagtggaccatcattcaaa
tctgttaacacctcagtgcatatatatgataaagcattcatcactgtgaaacatcgaaaa
cagcaggtgcttgaaacagtagctggcaagcgatcttaccggctctctatgaaagtgaag
gcatttccctcgccggaagttgtatggttaaaagatgggttacctgcgactgagaaatct
gctcgctatttgactcgtggctactcgttaattatcaaggacgtaactgaagaggatgca
gggaattatacaatcttgctgagcataaaacagtcaaatgtgtttaaaaacctcactgcc
actctaattgtcaatgtgaaaccccagatttacgaaaaggccgtgtcatcgtttccagac
ccagctctctacccactgggcagcagacaaatcctgacttgtactgcatatggtatccct
caacctacaatcaagtggttctggcacccctgtaaccataatcattccgaagcaaggtgt
gacttttgttccaataatgaagagtcctttatcctggatgctgacagcaacatgggaaac
agaattgagagcatcactcagcgcatggcagtaatagaaggaaagaataagacggctagc
accttggttgtggctgactctagaatttctggaatctacatttgcatagcttccaataaa
gttgggactgtgggaagaaacataagcttttatatcacagatgtgccaaatgggtttcat
gttaacttggaaaaaatgccgacggaaggagaggacctgaaactgtcttgcacagttaac
aagttcttatacagagacgttacttggattttactgcggacagttaataacagaacaatg
cactacagtattagcaagcaaaaaatggccatcactaaggagcactccatcactcttaat
cttaccatcttgaatgtttccctggaagattcaggcacctatgcctgcagagccaggaat
gtatacacaggggaagaaatcctccagaagaaagaaattacaatcagagatcaggaagca
ccatacctcctgcgaaacctcagtgatcacacagtggccatcagcagttccaccacttta
gactgtcatgctaatggtgtccccgagcctcagatcacttggtttaaaaacaaccacaaa
atacaacaagagcctggaattattttaggaccaggaagcagcacgctgtttattgaaaga
gtcacagaagaggatgaaggtgtctatcactgcaaagccaccaaccagaagggctctgtg
gaaagttcagcatacctcactgttcaaggaacctcggacaagtctaatctggagctgatc
actctaacatgcacctgtgtggctgcgactctcttctggctcctattaaccctctttatc
cgaaaaatgaaaaggtcttcttctgaaataaagactgactacctatcaattataatggac
ccagatgaagttcctttggatgagcagtgtgagcggctcccttatgatgccagcaagtgg
gagtttgcccgggagagacttaaactgggcaaatcacttggaagaggggcttttggaaaa
gtggttcaagcatcagcatttggcattaagaaatcacctacgtgccggactgtggctgtg
aaaatgctgaaagagggggccacggccagcgagtacaaagctctgatgactgagctcaaa
atcttgacccacattggccaccatctgaacgtggttaacctgctgggagcctgcaccaag
caaggagggcctctgatggtgattgttgaatactgcaaatatggaaatctctccaactac
ctcaagagcaaacgtgacttattttttctcaacaaggatgcagcactacacatggagcct
aagaaagaaaaaatggagccaggcctggaacaaggcaagaaaccaagactagatagcgtc
accagcagcgaaagctttgcgagctccggctttcaggaagataaaagtctgagtgatgtt
gaggaagaggaggattctgacggtttctacaaggagcccatcactatggaagatctgatt
tcttacagttttcaagtggccagaggcatggagttcctgtcttccagaaagtgcattcat
cgggacctggcagcgagaaacattcttttatctgagaacaacgtggtgaagatttgtgat
tttggcctcgcccgggatatttataagaaccccgattatgtgagaaaaggagatactcga
cttcctctgaaatggatggctcctgaatctatatttgacaaaatctacagcaccaagagc
gacgtgtggtcttacggagtattgctgtgggaaatcttctccttaggtgggtctccatac
ccaggagtacaaatggatgaggacttttgcagtcgcctgagggaaggcatgaggatgaga
gctcctgagtactctactcctgaaatctatcagatcatgctggactgctggcacagagac
ccaaaagaaaggccaagatttgcagaacttgtggaaaaactaggtgatttgcttcaagca
aatgtacaacaggatggtaaagactacatcccaatcaatgccatactgacaggaaatagt
gggtttacatactcaactcctgccttctctgaggacttcttcaaggaaagtatttcagct
ccgaagtttaattcaggaagctctgatgatgtcagatatgtaaatgctttcaagttcatg
agcctggaaagaatcaaaacctttgaagaacttttaccaaatgccacctccatgtttgat
gactaccagggggacagcagcactctgttggcctctcccatgctgaagcgcttcacttgg
actgacagcaaacccaaggcctcgctcaagattgacttgagagtaaccagtaaaagtaag
gagtcggggttgtctgatgtcagcaggcccagtttctgccattccagctgtgggcacgtc
agcgaaggcaagcgcaggttcacctacgaccacgctgagctggaaaggaaaatcgcgtgc
tgctccccgcccccagactacaactcggtggtcctgtactccaccccacccatctag

KEGG   Pan paniscus (bonobo): 100981139
Entry
100981139         CDS       T02283                                 

Gene name
FGFR2
Definition
(RefSeq) fibroblast growth factor receptor 2
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04144  Endocytosis
pps04151  PI3K-Akt signaling pathway
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04810  Regulation of actin cytoskeleton
pps05200  Pathways in cancer
pps05215  Prostate cancer
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100981139 (FGFR2)
   04014 Ras signaling pathway
    100981139 (FGFR2)
   04015 Rap1 signaling pathway
    100981139 (FGFR2)
   04020 Calcium signaling pathway
    100981139 (FGFR2)
   04151 PI3K-Akt signaling pathway
    100981139 (FGFR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100981139 (FGFR2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100981139 (FGFR2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100981139 (FGFR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100981139 (FGFR2)
   05230 Central carbon metabolism in cancer
    100981139 (FGFR2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100981139 (FGFR2)
   05215 Prostate cancer
    100981139 (FGFR2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100981139 (FGFR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100981139 (FGFR2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100981139 (FGFR2)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100981139 (FGFR2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100981139 (FGFR2)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100981139 (FGFR2)
CD molecules [BR:pps04090]
 Proteins
  100981139 (FGFR2)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100981139 (FGFR2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set Ig_5 Ig_6 ABC1 C2-set_2 Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100981139
NCBI-ProteinID: XP_008949230
Position
10
AA seq 841 aa
MGLTSTWRYGRGPGIGTVTMVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTK
YQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRD
SGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEK
MEKRLHAVPAANTVKFRCPAGGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESV
VPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY
SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICK
VSNYIGQANQSAWLTVLPKQQAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRM
KNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPML
AGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLK
DDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARR
PPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVM
KIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLG
GSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRI
LTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVK
T
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgggattaacgtccacatggagatatggaagaggaccggggattggtaccgtaaccatg
gtcagctggggtcgtttcatctgcctggtcgtggtcaccatggcgaccttgtccctggcc
cggccctccttcagtttagttgaggataccacattagagccagaagagccaccaaccaaa
taccaaatctctcaaccagaagtgtacgtggctgcgccaggggagtcgctagaggtgcgc
tgcctgttgaaagatgccgccgtgatcagttggactaaggatggggtgcacttggggccc
aacaataggacagtgcttattggggagtacttgcagataaagggcgccacgcctagagac
tccggcctctatgcttgtactgccagtaggactgtagacagtgaaacttggtacttcatg
gtgaatgtcacagatgccatctcatccggagatgatgaagatgacaccgatggtgcggaa
gattttgtcagtgagaacagtaacaacaagagagcaccatactggaccaacacagaaaag
atggaaaagcggctccatgctgtgcctgcggccaacactgtcaagtttcgctgcccagcc
ggggggaacccaacgccaaccatgcggtggctgaaaaacgggaaggagtttaagcaggag
catcgcattggaggctacaaggtacgaaaccagcactggagcctcattatggaaagcgtg
gtcccatctgacaagggaaattatacctgtgtggtggagaatgaatacgggtccatcaat
cacacgtaccacctggatgttgtggagcgatcgcctcaccggcccatcctccaagccgga
ctgccggcaaatgcctccacagtggtcggaggagacgtagagtttgtctgcaaggtttac
agtgatgcccagccccacatccagtggatcaagcacgtggaaaagaacggcagtaaatac
gggcccgacgggctgccctacctcaaggttctcaagcactcggggataaatagttccaat
gcagaagtgctggctctgttcaatgtgaccgaggcggatgctggggaatatatatgtaag
gtctccaattatatagggcaggccaaccagtctgcctggctcactgtcctgccaaaacag
caagcgcctggaagagaaaaggagattacagcttccccagactacctggagatagccatt
tactgcataggggtcttcttaatcgcctgtatggtggtaacagtcatcctgtgccgaatg
aagaacacgaccaagaagccagacttcagcagccagccggctgtgcacaagctgaccaaa
cgtatccccctgcggagacaggtaacagtttcggctgagtccagctcctccatgaactcc
aacaccccgctggtgaggataacaacacgcctctcttcaacggcagacacccccatgctg
gcaggggtctccgagtatgaacttccagaggacccaaaatgggagtttccaagagataag
ctgacactgggcaagcccctgggagaaggttgctttgggcaagtggtcatggcagaagca
gtgggaattgacaaagacaagcccaaggaggcggtcaccgtggccgtgaagatgttgaaa
gatgatgccacagagaaagacctttctgatctggtgtcagagatggagatgatgaagatg
attgggaaacacaagaatatcataaatcttcttggagcctgcacacaggatgggcctctc
tatgtcatagttgagtatgcctctaaaggcaacctccgagaatacctccgagcccggagg
ccacccgggatggagtactcctatgacattaaccgtgttcctgaggagcagatgaccttc
aaggacttggtgtcatgcacctaccagctggccagaggcatggagtacttggcttcccaa
aaatgtattcatcgagatttagcagccagaaatgttttggtaacagaaaacaatgtgatg
aaaatagcagactttggactcgccagagatatcaacaatatagactattacaaaaagacc
accaatgggcggcttccagtcaagtggatggctccagaagccctgtttgatagagtatac
actcatcagagtgatgtctggtccttcggggtgttaatgtgggagatcttcactttaggg
ggctcgccctacccagggattcccgtggaggaactttttaagctgctgaaggaaggacac
agaatggataagccagccaactgcaccaacgaactgtacatgatgatgagggactgttgg
catgcagtgccctcccagagaccaacgttcaagcagttggtagaagacttggatcgaatt
ctcactctcacaaccaatgaggaatacttggacctcagccaacctcttgaacagtattca
cctagttaccctgacacaagaagttcttgttcttcaggagatgattctgttttttctcca
gaccccatgccttacgaaccatgccttcctcagtatccacacataaacggcagtgttaaa
acatga

KEGG   Pan paniscus (bonobo): 100982337
Entry
100982337         CDS       T02283                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04072  Phospholipase D signaling pathway
pps04144  Endocytosis
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04540  Gap junction
pps04630  JAK-STAT signaling pathway
pps04810  Regulation of actin cytoskeleton
pps05163  Human cytomegalovirus infection
pps05200  Pathways in cancer
pps05206  MicroRNAs in cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100982337 (PDGFRA)
   04014 Ras signaling pathway
    100982337 (PDGFRA)
   04015 Rap1 signaling pathway
    100982337 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100982337 (PDGFRA)
   04020 Calcium signaling pathway
    100982337 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100982337 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100982337 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100982337 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100982337 (PDGFRA)
   04540 Gap junction
    100982337 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100982337 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100982337 (PDGFRA)
   05206 MicroRNAs in cancer
    100982337 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100982337 (PDGFRA)
   05231 Choline metabolism in cancer
    100982337 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100982337 (PDGFRA)
   05218 Melanoma
    100982337 (PDGFRA)
   05215 Prostate cancer
    100982337 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100982337 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100982337 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100982337 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100982337 (PDGFRA)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100982337 (PDGFRA)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100982337 (PDGFRA)
CD molecules [BR:pps04090]
 Proteins
  100982337 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Ig_6 C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 100982337
NCBI-ProteinID: XP_003806509
UniProt: A0A2R9AK21
Position
4
AA seq 1089 aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVSASYNSRQGFNG
TFTVGPYICEATVNGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNLSNIITEIHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccggcgttcctggtcttaggctgtcttctcacagggctgagccta
atcctctgccagctttcattaccctctatccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagagctccgatgtggaaatcagaaatgaagaaaacaacagcggcctt
tttgtgacggtcttggaagtgagcagtgcctcggcggcccacacagggttgtacacttgc
tattacaaccacactcagacagaagagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgtagcctttgtacctctaggaatgacggattatttagtcatcgtg
gaggatgatgattctgccattataccttgtcgcacaactgatcccgagactcctgtaacc
ttacacaacagtgagggggtggtatctgcctcctacaacagcagacagggctttaatggg
accttcactgtagggccctatatctgtgaggccaccgtcaacggaaagaagttccagacc
atcccatttaacgtttatgctttaaaagcaacatcagagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtggtcacctgtgctgtttttaacaat
gaggtggttgaccttcaatggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaagaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagaaagtcactatttctgtccatgagaaagggttcattgaaatcaaacccacc
ttcagccagttggaagctgtcaacctgcatgaagtcaaacattttgttgtagaggtgcgg
gcctacccacctcccaggatatcctggctgaaaaacaatctgactctgattgaaaatctc
actgagatcaccactgatgtggaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgctaaggaagaagacagtggccattatactattgtagctcaaaatgaagat
gctgtgaagagctatacttttgaactgttaactcaggttccttcatccattctggacttg
gtcgatgatcaccacggctcaactgggggacagacggtgaggtgcacagctgaaggcacg
ccgcttcctgatattgagtggatgatatgcaaggatattaagaaatgtaataatgaaact
tcctggacgattttggccaacaatctctcaaacatcatcacggagatccacccccgagac
aggagtaccgtggagggccgtgtgactttcgccaaagtggaggagaccatcgcggtgcga
tgcctggctaagaatctccttggagctgagaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcaccgtggctgctgcagtcctggtgctgttggtgattgtgatcatc
tcacttattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagcccagatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcaagatgggagtttccaagagatggactagtgcttggtcgggtcttgggg
tctggagcgtttgggaaggtggttgaaggaacagcctatggattaagccggtcccaacct
gtcatgaaagttgcagtgaagatgctaaaacccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttgaacattgtaaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacagagtattgcttctatgga
gatttggtcaactatttgcataagaatagggatagcttcctgagccaccacccagagaag
ccaaagaaagagctggatatctttggattgaaccctgctgatgaaagcacacggagctat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgatactaca
caatatgtccccatgctagaaaggaaagaggtttctaaatattccgacatccagagatca
ctctatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttattggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgtgatctggct
gctcgcaacgtcctcctggcacaaggaaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactatgtgtcgaaaggcagtacctttctgcccgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgatgtctggtct
tacggcattctgctctgggagatcttttcccttggtggcaccccttaccccggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gctaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcacctggacttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactcagacaatgcatacattggtgtcacctacaaaaacgaggaagacaagctg
aaggactgggagggtggtctggatgagcagagactgagcgctgacagtggctacatcatt
cctctgcctgacattgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccattgagacgggttccagcagttccaccttcatc
aagagagaggacgagaccattgaagacatcgacatgatggacgacatcggcatagactct
tcagacctggtggaagacagcttcctgtaa

KEGG   Pan paniscus (bonobo): 100982426
Entry
100982426         CDS       T02283                                 

Gene name
MST1R
Definition
(RefSeq) macrophage stimulating 1 receptor
  KO
K05100  macrophage-stimulating 1 receptor [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100982426 (MST1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100982426 (MST1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100982426 (MST1R)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100982426 (MST1R)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  MET family
   100982426 (MST1R)
CD molecules [BR:pps04090]
 Proteins
  100982426 (MST1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100982426
NCBI-ProteinID: XP_003818889
UniProt: A0A2R9AM93
Position
3
AA seq 1400 aa
MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYTASRDFDVKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT
KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIRGPGCRHFLTCGRCLRAW
HFMGCGWCGNMCSQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLERVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV
GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLG
ILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSG
LALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAEVKDVLIPHERV
VTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLNH
LNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYLA
EQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ
TYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVM
QQCWEADPAVRPTFGVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQF
SPMPGNVRRPRPLSEPPRPT
NT seq 4203 nt   +upstreamnt  +downstreamnt
atggagctcctcccgccgctgcctcagtccttcctgttgctgctgctgttgcctgccaag
cccgcggcgggcgaggactggcagtgcccgcgcaccccctacacggcctctcgcgacttt
gacgtgaagtacgtggtgcccagcttctccgccggaggcctggtacaggccatggtgacc
tacgagggcgacagaaatgagagtgctgtgtttgtagccatacgcaatcgcctgcatgtg
cttgggcctgacttgaagtctgtccagagcctggccacgggccctgctggagaccctggc
tgccagacgtgtgcagcctgtggcccaggaccccacggccctcccggtgacacagacaca
aaggtgctggtgctggatcccgcgctgcctgcgctggtcagttgtggctccagcctgcag
ggccgctgcttcctgcatgacctagagccccaagggacagccgtgcatctggcagcgcca
gcctgcctcttctcagcccaccataaccggcccgatgactgccccgactgtgtggccagc
ccattgggcacccgtgtaactgtggttgagcaaggccaggcctcctatttctacgtggca
tcctcactggacgcagccgtggctgccagcttcagcccacgctcagtgtctatcaggcgt
ctcaaggccgacgcctccggattcgcaccgggctttgtggcgttgtcagtgctgcccaag
catcttgtctcctacagtattgaatacgtgcacagcttccacacgggagccttcgtatac
ttcctgactgtacagccggccagcgtgacagatgatcctagtgccctgcacacacgcctg
gcacggcttagcgccactgagccagagttgggtgactatcgggagctggtcctcgactgc
agatttgctccaaaacgcaggcgccggggggccccagaaggcggacagccctaccctgtg
ctgcgggtggcccactccgctccagtgggtgcccaacttgccactgagctgagcatcgcc
gagggccaggaagtactatttggggtctttgtgactggcaaggatggtggtcctggcgtg
ggccccaactctgtcgtctgtgccttccccattgacctgctggacacactaattgatgag
ggtgtggagcgctgttgtgaatccccagtccatccaggcctccggcgaggcctcgacttc
ttccagtcgcccagtttttgccccaacccgcctggcctggaagccctcagccccaacacc
agctgccgccacttccctctgctggtcagtagcagcttctcacgtgtggacctattcaat
gggctgttgggaccagtacaggtcactgcattgtatgtgacacgccttgacaatgtcaca
gtggcgcacatgggcacaatggatgggcgtatcctgcaggtggagctggtcaggtcacta
aactacttgctgtatgtgtccaacttctcactgggtgacagtgggcagcccgtgcagcgg
gatgtcagtcgtcttggggaccacctactcttcgcctctggggaccaggttttccaggta
ccaatccgaggccctggctgccgccacttcctgacctgtgggcgttgcctaagggcatgg
catttcatgggctgtggctggtgtgggaacatgtgcagccagcagaaggagtgtcctggc
tcctggcaacaggaccactgcccacctaagcttactgagttccacccccacagtggacct
ctaaggggcagtacaaggctgaccctgtgtggctccaacttctaccttcacccttctggt
ctggtgcctgagggaacccatcaggtcactgtgggccaaagtccctgccggccactgccc
aaggacagctcaaaactcagaccagtgccccggaaagactttgtagaggagtttgagtgt
gaactggagcccttgggcacccaggcagtggggcctaccaacgtcagcctcaccgtgact
aacatgccaccgggcaagcacttccgggtagacggcacctccgtgctgagaggcttctct
ttcatggagccagtgctgatagcagtgcaacccctctttggcccacgggcaggaggcacc
tgtctcactcttgaaggccagagtctgtctgtaggcaccagccgggctgtgctggtcaat
gggactgagtgtctgctagaacgggtcagtgaggggcagcttttatgtgccacaccccct
ggggccacggtggccagtgtcccccttagcctgcaggtggggggtgcccaggtacctggt
tcctggaccttccagtacagagaagaccctgttgtgctaagcatcagccccaactgtggc
tacatcaactcccacatcaccatctgtggccagcatctaacttcagcatggcacttagtg
ctgtcattccatgacgggcttagggcagtggaaagcaggtgtgagaggcagcttccagag
cagcagctgtgccgccttcctgaatatgtggtccgagacccccagggatgggtggcaggg
aatctgagtgcccggggggatggagctgctggctttacactgcctggctttcgcttccta
cccccaccccatccacccagtgccaacctagttccactgaagcctgaggagcatgccatt
aagtttgagtatattgggctgggcgctgtggctgactgtgtgggtatcaacgtgaccgtg
ggtggtgagagctgccagcacgagttccggggggacatggttgtctgccccctgccccca
tccctgcagcttggccaggatggtgccccattgcaggtctgcgtagatggtgaatgtcat
atcctgggtagagtggtgcggccagggccagacggggtcccacagagcacgctccttggt
atcctgctgcctttgctgctgcttgtggctgcactggcgactgcactggtcttcagctac
tggtggcggaggaagcagctagttcttcctcccaacctgaatgacttggcatccctggac
cagactgctggagccacacccctgcctattctgtactcgggctctgactacagaagtggc
cttgcactccctgccattgatggtctggattccaccacttgtgtccatggagcatccttc
tccgatagtgaagatgaatcctgtgtgccactgctgcggaaagagtccatccagctaagg
gacctggactctgcgctcttggctgaggtcaaggatgtgctgattccccatgagcgggtg
gtcacccacagtgaccgagtcattggcaaaggccactttggagttgtctaccacggagaa
tacatagaccaggcccagaatcgaatccaatgtgccatcaagtcactaagtcgcatcaca
gagatgcagcaggtggaggccttcctgcgagaggggctgctcatgcgtggcctgaaccac
ctgaatgtgctggctctcattggtatcatgttgccacctgagggcctgccccatgtgctg
ctgccctatatgtgccacggtgacctgctccagttcatccgctcacctcagcggaacccc
accgtgaaggacctcatcagctttggcctgcaggtagcccgcggcatggagtacctggca
gagcagaagtttgtgcacagggacctggctgcgcggaactgcatgctggacgagtcattc
acagtcaaggtggctgactttggtttggcccgcgacatcctggacagggagtactatagt
gttcaacagcatcgccacgctcgcctacctgtgaagtggatggcgctggagagcctgcag
acctatagatttaccaccaagtctgatgtgtggtcatttggtgtgctgctgtgggaactg
ctgacacggggtgccccaccataccgccacattgacccttttgaccttacccacttcctg
gcccagggtcggcgcctgccccagcctgagtattgccctgattctctgtaccaagtgatg
cagcaatgctgggaggcagacccagcagtgcgacccaccttcggagtactagtgggggag
gtggagcagatagtgtctgcactgcttggggaccattatgtgcagctgccagcaacctac
atgaacttgggccccagcacctcgcatgagatgaatgtgcgtccagaacagccgcagttc
tcacccatgccagggaatgtacgccggccccggccactctcagagcctcctcggcccact
tga

KEGG   Pan paniscus (bonobo): 100986594
Entry
100986594         CDS       T02283                                 

Gene name
KDR
Definition
(RefSeq) kinase insert domain receptor
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04370  VEGF signaling pathway
pps04510  Focal adhesion
pps05205  Proteoglycans in cancer
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100986594 (KDR)
   04014 Ras signaling pathway
    100986594 (KDR)
   04015 Rap1 signaling pathway
    100986594 (KDR)
   04370 VEGF signaling pathway
    100986594 (KDR)
   04020 Calcium signaling pathway
    100986594 (KDR)
   04151 PI3K-Akt signaling pathway
    100986594 (KDR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100986594 (KDR)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100986594 (KDR)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100986594 (KDR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100986594 (KDR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100986594 (KDR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100986594 (KDR)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100986594 (KDR)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   100986594 (KDR)
CD molecules [BR:pps04090]
 Proteins
  100986594 (KDR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C2-set_2 Ig_4 TCAD9 Haspin_kinase
Other DBs
NCBI-GeneID: 100986594
NCBI-ProteinID: XP_003806519
UniProt: A0A2R9CED2
Position
4
AA seq 1356 aa
MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGE
KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPVKYLGYPPP
EIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECPNEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLT
VLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV
NT seq 4071 nt   +upstreamnt  +downstreamnt
atgcagagcaaggtgctgctggccgtcgccctgtggctctgcgtggagacccgggccgcc
tctgtgggtttgcctagtgtttctcttgatctgcccaggctcagcatacaaaaagacata
cttacaattaaggctaatacaactcttcaaattacttgcaggggacagagggacttggac
tggctttggcccaataatcagagtggcagtgagcaaagggtggaggtgactgagtgcagc
gatggcctcttctgtaagacactcacaattccaaaagtgatcggaaatgacactggagcc
tacaagtgcttctaccgggaaactgacttggcctcggtcatttatgtctatgttcaagat
tacagatctccatttattgcttctgttagtgaccaacatggagtcgtgtacattactgag
aacaaaaacaaaactgtggtgattccatgtctcgggtccatttcaaatctcaacgtgtca
ctttgtgcaagatacccagaaaagagatttgttcctgatggtaacagaatttcctgggac
agcaagaagggctttactattcccagctacatgatcagctatgctggcatggtcttctgt
gaagcaaaaattaatgatgaaagttaccagtctattatgtacatagttgtcgttgtaggg
tataggatttatgatgtggttctgagtccgtctcatggaattgaactatctgttggagaa
aagcttgtcttaaattgtacagcaagaactgaactaaatgtggggattgacttcaactgg
gaatacccttcttcgaagcatcagcataagaaacttgtaaaccgagacctaaaaacccag
tctgggagtgagatgaagaaatttttgagcaccttaactatagatggtgtaacccggagt
gaccaaggattgtacacctgtgcagcgtccagtgggctgatgaccaagaagaacagcaca
tttgtcagggtccacgaaaaaccttttgttgcttttggaagtggcatggaatctctggtg
gaagccacggtgggggagcgtgtcagaatcccagtgaagtaccttggttacccaccccca
gaaataaaatggtataaaaatggaataccccttgagtccaatcacacaattaaagcaggg
catgtactgacgattatggaagtgagtgaaagagacacaggaaattatactgtcatcctt
accaatcccatttcaaaggagaagcagagccatgtggtctctctggttgtgtatgtccca
ccccagattggtgagaaatctctaatctctcctgtggattcctaccagtacggcaccact
caaacactgacatgtacggtctatgccattcctcccccgcatcacatccactggtattgg
cagttggaggaagagtgccccaacgagcccagccaagctgtctcagtgacaaatccatac
ccttgtgaagaatggagaagtgtggaggacttccagggaggaaataaaattgaagttaat
aaaaatcaatttgctctaattgaaggaaaaaacaaaactgtaagtacccttgttatccaa
gcggcaaatgtgtcagctttgtacaaatgtgaagcggtcaacaaagtcgggagaggagag
agggtgatctccttccacgtgaccaggggtcctgaaattactttgcaacctgacatgcag
cccactgagcaggagagcgtgtctttgtggtgcactgcagacagatctacgtttgagaac
ctcacatggtacaagcttggcccacagcctctgccaatccatgtgggagagttgcccaca
cctgtttgcaagaacttggatactctttggaaattgaatgccaccatgttctctaatagc
acaaatgacattttgatcatggagcttaagaatgcatccttgcaggaccaaggagactat
gtctgccttgctcaagacaggaagaccaagaaaagacattgcgtggtcaggcagctcaca
gtcctagagcgtgtggcacccacgatcacaggaaacctggagaatcagacgacaagtatt
ggggaaagcatcgaagtctcatgcacggcatctgggaatccccctccacagatcatgtgg
tttaaagataatgagacccttgtagaagactcaggcattgtattgaaggatgggaaccgg
aacctcactatccgcagagtgaggaaggaggacgaaggcctctacacctgccaggcatgc
agtgttcttggctgtgcaaaagtggaggcatttttcataatagaaggtgcccaggaaaag
acgaacttggaaatcattattctagtaggcacggcggtgattgccatgttcttctggcta
cttcttgtcatcatcctacggaccgttaagcgggccaatggaggggaactgaagacaggc
tacttgtccatcgtcatggatccagatgaactcccattggatgaacattgtgaacgactg
ccttatgatgctagcaaatgggaattccccagagaccggctgaagctaggtaagcctctt
ggccgtggtgcctttggccaagtgattgaagcagatgcctttggaattgacaagacagca
acttgcaggacagtagcagtcaaaatgttgaaagaaggagcaacacacagtgagcatcga
gctctcatgtctgaactcaagatcctcattcatattggtcaccatctcaatgtggtcaac
cttctaggtgcctgtaccaagccaggagggccactcatggtgattgtggaattctgcaaa
tttggaaacctatccacttacctgaggagcaagagaaatgaatttgtcccctacaagacc
aaaggggcacgattccgtcaagggaaagactacgttggagcaatccctgtggatctgaaa
cggcgcttggacagcatcaccagtagccagagctcagccagctctggatttgtggaggag
aagtccctcagtgatgtagaagaagaggaagctcctgaagatctgtataaggacttcctg
accttggagcatctcatctgttacagcttccaagtggctaagggcatggagttcttggca
tcgcgaaagtgtatccacagggacctggcggcacgaaatatcctcttatcggagaagaac
gtggttaaaatctgtgactttggcttggcccgggatatttataaagatccagattatgtc
agaaaaggagatgctcgcctccctttgaaatggatggccccagaaacaatttttgacaga
gtgtacacaatccagagtgacgtctggtcttttggtgttttgctgtgggaaatattttcc
ttaggtgcttctccatatcctggggtaaagattgatgaagaattttgtaggcgattgaaa
gaaggaactagaatgagggcccctgattatactacaccagaaatgtaccagaccatgctg
gactgctggcacggggagcccagtcagagacccacgttttcagagttggtggaacatttg
ggaaatctcttgcaagctaatgctcagcaggatggcaaagactacattgttcttccgata
tcagagactttgagcatggaagaggattctggactctctctgcctacctcacctgtttcc
tgtatggaggaggaggaagtatgtgaccccaaattccattatgacaacacagcaggaatc
agtcagtatctgcagaacagtaagcgaaagagccggcctgtgagtgtaaaaacatttgaa
gatatcccattagaagaaccagaagtaaaagtaatcccagatgacaaccagacggacagt
ggtatggttcttgcctcagaagagctgaaaactttggaagacagaaccaaattatctcca
tcttttggtggaatggtgcccagcaaaagcagggagtctgtggcatctgaaggctcaaac
cagacaagcggctaccagtccggatatcactccgatgacacagacaccactgtgtactcc
agtgaggaagcagaacttttaaagctgatagagattggagtgcaaaccggtagcacagcc
cagattctccagcctgactcggggaccacactgagctctcctcctgtttaa

KEGG   Pan paniscus (bonobo): 100988115
Entry
100988115         CDS       T02283                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04520  Adherens junction
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04714  Thermogenesis
pps04810  Regulation of actin cytoskeleton
pps04928  Parathyroid hormone synthesis, secretion and action
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05215  Prostate cancer
pps05218  Melanoma
pps05224  Breast cancer
pps05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100988115 (FGFR1)
   04014 Ras signaling pathway
    100988115 (FGFR1)
   04015 Rap1 signaling pathway
    100988115 (FGFR1)
   04020 Calcium signaling pathway
    100988115 (FGFR1)
   04151 PI3K-Akt signaling pathway
    100988115 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100988115 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100988115 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100988115 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100988115 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100988115 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100988115 (FGFR1)
   05205 Proteoglycans in cancer
    100988115 (FGFR1)
   05230 Central carbon metabolism in cancer
    100988115 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    100988115 (FGFR1)
   05215 Prostate cancer
    100988115 (FGFR1)
   05224 Breast cancer
    100988115 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100988115 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100988115 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100988115 (FGFR1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100988115 (FGFR1)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100988115 (FGFR1)
CD molecules [BR:pps04090]
 Proteins
  100988115 (FGFR1)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100988115 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Ig_5 C2-set_2 Ig_4 ABC1 Pkinase_fungal TCAD9 DUF1615 DUF4611
Other DBs
NCBI-GeneID: 100988115
NCBI-ProteinID: XP_008954378
Position
8
AA seq 822 aa
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactctgcacc
gctaggccgtccccgaccttgcctgaacaagcccagccctggggagcccctgtggaagtg
gagtccttcctggtccaccccggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtgcagagcatcaactggctgcgggacggggtgcagctggcggaaagcaaccgcacccgc
atcacaggggaggaggtggaggtgcaggactccgtgcccgcagactccggcctctatgct
tgcgtaaccagcagcccctcgggcagtgacaccacctacttctccgtcaatgtttcagat
gctctcccctcctcggaggatgatgatgatgatgatgactcctcttcagaggagaaagaa
acagataacaccaaaccaaaccgtatgcccgtagctccatattggacatccccagaaaag
atggaaaagaaattgcatgcagtgccggctgccaagacagtgaagttcaaatgcccttcc
agtgggaccccaaaccccacactgcgctggttgaaaaatggcaaagaattcaaacctgac
cacagaattggaggctacaaggtccgttatgccacctggagcatcataatggactctgtg
gtgccctctgacaagggcaactacacctgcattgtggagaatgagtacggcagcatcaac
cacacataccagctggatgtcgtggagcggtcccctcaccggcccatcctgcaagcaggg
ttgcccgccaacaagacagtggccctgggtagcaacgtggagttcatgtgtaaggtgtac
agtgacccgcagccgcacatccagtggctaaagcacatcgaggtgaacgggagcaagatt
ggcccagacaacctgccttatgtccagatcctgaagactgctggagttaataccaccgac
aaagagatggaggtgcttcacttaagaaatgtctcctttgaggacgcaggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagaggccggcagtgatgacctcgcccctgtacctggagatcatcatctat
tgcacaggggccttcctcatctcctgcatggtggggtcggtcatcgtctacaagatgaag
agtggtaccaagaagagtgacttccacagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtaacagtgtctgctgactccagtgcatccatgaactctggg
gttcttctggttcggccatcacggctctcctccagtgggactcccatgctagcaggggtc
tctgagtatgagcttcccgaagaccctcgctgggagctgcctcgggacagactggtctta
ggcaaacccctgggagagggctgctttgggcaggtggtgttggcagaggctatcgggctg
gacaaggacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggacgca
acagagaaagacttgtcagacctgatctcagaaatggagatgatgaagatgatcgggaag
cataagaatatcatcaacctgctgggggcctgcacgcaggatggtcccttgtatgtcatc
gtggagtatgcctccaagggcaacctgcgggagtacctgcaggcccggaggcccccaggg
ctggaatactgctacaaccccagccacaacccagaggagcagctctcctccaaggacctg
gtgtcctgcgcctaccaggtggcccgaggcatggagtatctggcctccaagaagtgcata
caccgagacctggcagccaggaatgtcctggtgacagaggacaatgtgatgaagatagca
gactttggcctcgcacgggacattcaccacatcgactactataaaaagacaaccaacggc
cgactgcctgtgaagtggatggcacccgaggcattatttgaccggatctacacccaccag
agtgatgtgtggtctttcggggtgctcctgtgggagatcttcactctgggcggctcccca
taccccggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcaccgcatggac
aagcccagtaactgcaccaacgagctgtacatgatgatgcgggactgctggcatgcagtg
ccctcacagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttg
acctccaaccaggagtacctggacctgtccatgcccctggaccagtactcccccagcttt
cccgacacccggagctctacgtgctcctcaggggaggattccgtcttctctcatgagccg
ctgcccgaggagccctgcctgccccgacacccagcccagcttgccaatggcggactcaaa
cgccgctga

KEGG   Pan paniscus (bonobo): 100991315
Entry
100991315         CDS       T02283                                 

Gene name
FGFR4
Definition
(RefSeq) fibroblast growth factor receptor 4
  KO
K05095  fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04144  Endocytosis
pps04151  PI3K-Akt signaling pathway
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04810  Regulation of actin cytoskeleton
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100991315 (FGFR4)
   04014 Ras signaling pathway
    100991315 (FGFR4)
   04015 Rap1 signaling pathway
    100991315 (FGFR4)
   04020 Calcium signaling pathway
    100991315 (FGFR4)
   04151 PI3K-Akt signaling pathway
    100991315 (FGFR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100991315 (FGFR4)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100991315 (FGFR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100991315 (FGFR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100991315 (FGFR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100991315 (FGFR4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100991315 (FGFR4)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100991315 (FGFR4)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100991315 (FGFR4)
CD molecules [BR:pps04090]
 Proteins
  100991315 (FGFR4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig V-set C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 100991315
NCBI-ProteinID: XP_003806899
UniProt: A0A2R9BFK6
Position
5
AA seq 802 aa
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPRLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITDDS
LTSSNDHEDPKSHRDPSNRHIYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEARYTDVILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgcggctgctgctggccctgttgggggtcctgctgagtgtgcctgggcctccagtcttg
tccctggaggcctctgaggaagtggagcttgagccctgcctggctccccgcctggagcag
caagagcaggagctgacagtagcccttgggcagcctgtgcggctgtgctgtgggcgggct
gagcgtggtggccactggtacaaggagggcagtcgcctggcacctgctggccgtgtacgg
ggctggaggggccgcctagagattgccagcttcctacctgaggatgctggccgctacctc
tgcctggcacgaggctccatgatcgtcctgcagaatctcaccttgattacagacgactcc
ttgacctccagcaacgatcatgaggaccccaagtcccatagggacccctcgaataggcac
atttacccccagcaagcaccctactggacacacccccagcgcatggagaagaaactgcat
gcggtacctgcggggaacaccgtcaagttccgctgtccagctgcaggcaaccccacgccc
accatccgctggcttaaggatggacaggcctttcatggggagaaccgcattggaggcatt
cggctgcgccatcagcactggagtctcgtgatggagagcgtggtgccctcggaccgcggc
acatacacctgcctggtagagaacgctgtgggcagcatccgctataactacctgctagat
gtgctggagcggtccccgcaccggcccatcctgcaggccgggctcccggccaacaccaca
gccgtggtgggcagcgacgtggagctgctgtgcaaggtgtacagcgatgcccagccccac
atccagtggctgaagcacatcgtcatcaacggcagcagctttggagccgacggtttcccc
tatgtgcaagtcctaaagactgcagacatcaatagctcagaggtggaggtcctgtacctg
cggaacgtgtcagccgaggacgcaggcgagtacacctgccttgcaggcaattccatcggc
ctctcctaccagtctgcctggctcacagtgctgccagaggaggaccccacgtggaccgca
gcagcgcccgaggccaggtatacggacgtcatcctgtacgcgtcgggctccctggccttg
gcggtgctcctgctgctggccgggctgtatcgagggcaggcgctccacggccggcacccc
cgcccgcccgccactgtgcagaagctctcccgcttccctctggcccgacagttctccctg
gagtcaggctcttccggcaagtcaagctcatccctggtacgaggcgtgcgtctctcctcc
agcggccccgccttgctcgccggcctcgtgagtctagatctacctctcgacccactatgg
gagttcccccgggacaggctggtgcttgggaagcccctaggcgagggctgctttggccag
gtagtacgtgcagaggcctttggcatggaccctgcccggcctgaccaagccagcactgtg
gccgtcaagatgctcaaagacaacgcctctgacaaggacctggccgacctggtctcagag
atggaggtgatgaagctgattggccgacacaagaacatcatcaacctgcttggtgtctgc
acccaggaagggcccctgtacgtgatcgtggagtgtgccgccaagggaaacctgcgggag
ttcctgcgggcccggcgccccccaggccccgacctcagccccgacggtcctcggagcagt
gaggggccgctctccttcccagtcctggtctcctgcgcctaccaggtggcccgaggcatg
cagtatctggagtcccggaagtgtatccaccgggacctggctgcccgcaatgtgctggtg
accgaggacaatgtgatgaagattgctgactttgggctggcccgcggcgtccaccacatt
gactactataagaaaaccagcaacggccgcctgcctgtcaagtggatggcgcccgaggcc
ttgtttgaccgggtgtacacacaccagagtgacgtgtggtcttttgggatcctgctatgg
gagatcttcaccctcgggggctccccgtatcctggcatcccggtggaggagctgttctcg
ctgctgcgggagggacatcggatggaccgacccccacactgccccccagagctgtacggg
ctgatgcgtgagtgctggcacgcggcaccctcccagaggcctaccttcaagcagctggtg
gaggcgctggacaaggtcctgctggccgtctctgaggagtacctcgacctccgcctgacc
ttcggaccctattccccctctggtggggacgccagcagcacctgctcctccagcgattct
gtcttcagccacgaccccctgccattgggatccagctccttccccttcgggtctggggtg
cagacatga

KEGG   Pan paniscus (bonobo): 100991777
Entry
100991777         CDS       T02283                                 

Gene name
MET
Definition
(RefSeq) MET proto-oncogene, receptor tyrosine kinase
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04360  Axon guidance
pps04510  Focal adhesion
pps04520  Adherens junction
pps05100  Bacterial invasion of epithelial cells
pps05144  Malaria
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05211  Renal cell carcinoma
pps05218  Melanoma
pps05223  Non-small cell lung cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100991777 (MET)
   04014 Ras signaling pathway
    100991777 (MET)
   04015 Rap1 signaling pathway
    100991777 (MET)
   04020 Calcium signaling pathway
    100991777 (MET)
   04151 PI3K-Akt signaling pathway
    100991777 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100991777 (MET)
   04520 Adherens junction
    100991777 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100991777 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100991777 (MET)
   05202 Transcriptional misregulation in cancer
    100991777 (MET)
   05206 MicroRNAs in cancer
    100991777 (MET)
   05205 Proteoglycans in cancer
    100991777 (MET)
   05230 Central carbon metabolism in cancer
    100991777 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100991777 (MET)
   05226 Gastric cancer
    100991777 (MET)
   05218 Melanoma
    100991777 (MET)
   05211 Renal cell carcinoma
    100991777 (MET)
   05223 Non-small cell lung cancer
    100991777 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100991777 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    100991777 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100991777 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100991777 (MET)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100991777 (MET)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  MET family
   100991777 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100991777
NCBI-ProteinID: XP_008958968
Position
7
AA seq 1409 aa
MKSKSKSLAECLPHDKPLIMKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKY
QLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDC
SSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCI
FSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKE
TKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRF
CSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDI
LFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRT
LLRNSSSCEARRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGR
FMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVVTGKKITKIPLNGLGCR
HFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRL
TICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIIS
NGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKS
VSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTIT
GVGKNLNSVSVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFF
MLDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKS
CENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSI
SIALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESV
DYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPE
LVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEV
SQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDL
IGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKT
GAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRR
LLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKC
VAPYPSLLSSEDNADDEVDTRPASFWETS
NT seq 4230 nt   +upstreamnt  +downstreamnt
atgaagagtaaatcaaagagtttagcagaatgcctcccacatgataaacctctcataatg
aaggcccccgctgtgcttgcacctggcatcctcgtgctcctgtttaccttggtgcagagg
agcaatggggagtgtaaagaggcactagcaaagtccgagatgaatgtgaatatgaagtat
cagcttcccaacttcaccgcggaaacacccatccagaatgtcattctacatgagcatcac
attttcctcggtgccactaactacatttatgttttaaatgaggaagaccttcagaaggtt
gctgagtacaagactgggcctgtgctggaacacccagattgtttcccatgtcaggactgc
agcagcaaagccaatttatcaggaggtgtttggaaagataacatcaacatggctctagtt
gtcgacacctactatgatgatcaactcattagctgtggcagcgtcaacagagggacctgc
cagcgacatgtctttccccacaatcatactgctgacatacagtcggaggttcactgcata
ttctccccacagatagaagagcccagccagtgtcctgactgtgtggtgagcgccctggga
gccaaagtcctttcatctgtaaaggaccggttcatcaacttctttgtaggcaataccata
aattcttcttatttcccagatcatccgttgcattcaatatcagtgagaaggctaaaggaa
acgaaagatggttttatgtttttgacagaccagtcctacattgatgttttacctgagttc
agagattcttaccccattaagtatgtccatgcctttgaaagcaacaattttatttacttc
ttgacggtccaaagggaaactctagatgctcagacttttcacacaagaataatcaggttc
tgttccataaactctggattgcattcctacatggaaatgcctctggagtgtattctcaca
gaaaagagaaaaaagagatccacaaagaaggaagtgtttaatatccttcaggctgcgtat
gtcagcaagcctggggcccagcttgctagacaaataggagccagcctgaatgatgacatt
cttttcggggtgttcgcacaaagcaagccagattctgccgaaccaatggatcgatctgcc
atgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgtcaacaaaaac
aatgtgagatgtctccagcatttttacggacccaatcatgagcactgttttaataggaca
cttctgagaaattcatcaagctgtgaagcgcgccgtgatgaatatcgaacagagtttacc
acagctttgcagcgcgttgacttattcatgggtcaattcagcgaagtcctcttaacatct
atatccaccttcattaaaggagacctcaccatagctaatcttgggacatcagagggtcgc
ttcatgcaggttgtggtttctcgatcaggaccatcaacccctcatgtgaattttctcctg
gactcccatccagtgtctccagaagtgattgtggagcatacattaaaccagaatggctac
acactggttgtcactgggaagaagatcacgaagatcccattgaatggcttgggctgcaga
catttccagtcctgcagtcagtgcctctctgccccaccctttgttcagtgtggctggtgc
cacgacaaatgtgtgcgatcggaggaatgcctgagcgggacatggactcaacagatctgt
ctgcctgcaatctacaaggttttcccaaatagtgcaccccttgaaggagggacaaggctg
accatatgtggctgggactttggatttcggaggaataataaatttgatttaaagaaaact
agagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgatgaataca
ttgaaatgcacagttggtcctgccatgaataagcatttcaatatgtccataattatttca
aatggccacgggacaacacaatacagtacattctcctatgtggatcctgtaataacaagt
atttcgccgaaatacggtcctatggctggtggcactttacttactttaactggaaattac
ctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtactttaaaaagt
gtgtcaaacagtattcttgaatgttataccccagcccaaaccatttcaactgagtttgct
gttaaattgaaaattgacttagccaaccgagagacaagcatcttcagttaccgggaagat
cccattgtctatgaaattcatccaaccaaatcttttattagtggtgggagcacaataaca
ggtgttgggaaaaacctgaattcagttagtgtcccgaggatggtcataaatgtgcatgaa
gcaggaaggaattttacagtggcatgtcaacatcgctctaattcagagataatctgttgt
accactccttccctgcaacagctgaatctgcaactccccctgaaaaccaaagcctttttc
atgttagatgggatcctttccaaatactttgatctcatttatgtacataatcctgtgttt
aagccttttgaaaagccagtgatgatctcaatgggcaatgaaaatgtactggaaattaag
ggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataagagc
tgtgagaatatacacttacattctgaagccgttttatgcacggtccccaatgacctgctg
aaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaaccgtccttgga
aaagtaatagttcaaccagatcagaatttcacaggattgattgctggtgttgtctcaata
tcaatagcactgttattactacttgggtttttcctgtggctgaaaaagagaaagcaaatt
aaagatctgggcagtgaattagttcgctacgatgcaagagtacacactcctcatttggat
aggctcgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaatctgta
gactaccgagctacttttccagaagatcagtttcctaattcatctcagaacggttcatgc
cgacaagtgcagtatcctctgacagacatgtcccccatcctaactagtggggactctgat
atatccagtccattactgcaaaatactgtccacattgacctcagtgctctaaatccagag
ctggtccaggcagtgcagcatgtagtgattgggcccagtagcctgattgtgcatttcaat
gaagtcataggaagagggcattttggttgtgtatatcatgggactttgttggacaatgat
ggcaagaaaattcactgtgctgtgaaatccttgaacagaatcactgacataggagaagtt
tcccaatttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtcctctcg
ctcctgggaatctgcctgcgaagtgaagggtctccgctggtggtcctaccatacatgaaa
catggagatcttcgaaatttcattcgaaatgagactcataatccaactgtaaaagatctt
attggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagtttgtc
cacagagacttggctgcaagaaactgtatgctggatgaaaaattcacagtcaaggttgct
gattttggtcttgccagagacatgtatgataaagaatactatagtgtacacaacaaaaca
ggtgcaaagctgccagtgaagtggatggctttggaaagtctgcaaactcaaaagtttacc
accaagtcagatgtgtggtcctttggcgtgctcctctgggagctgatgacaagaggagcc
ccaccttatcctgatgtgaacacctttgatataactgtttacttgttgcaagggagaagg
ctcctacaacccgaatactgcccagaccccttatacgaagtaatgctaaaatgctggcac
cctaaagccgaaatgcgcccatccttttctgaactggtgtcccggatatcagcgatcttc
tctactttcattggggagcactatgtccatgtgaacgctacttatgtgaacgtaaaatgt
gtcgctccatatccttctctgttgtcatcagaagataacgctgatgatgaggtggacaca
cgaccagcctccttctgggagacatcatag

KEGG   Pan paniscus (bonobo): 100994039
Entry
100994039         CDS       T02283                                 

Gene name
RET
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps05200  Pathways in cancer
pps05216  Thyroid cancer
pps05223  Non-small cell lung cancer
pps05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100994039 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100994039 (RET)
   05230 Central carbon metabolism in cancer
    100994039 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100994039 (RET)
   05223 Non-small cell lung cancer
    100994039 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100994039 (RET)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100994039 (RET)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  RET family
   100994039 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD3 RET_CLD4 Pkinase Cadherin Pkinase_fungal RIO1 TCAD9 Haspin_kinase ABC1
Other DBs
NCBI-GeneID: 100994039
NCBI-ProteinID: XP_003816765
Position
10
AA seq 1129 aa
MEMPRLLISMLHTSIETGLTAQGLDMAGENAAPPSHPEGTVMGAVFLMCVLEEPSGPGGV
LNCCCRPRPPDPSATSSSNRLVALGLYFSRDAYWEKLYVDQPAGTPLLYVHALRDAPEEV
PSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLTVYL
KVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENRPPG
TFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELVAVC
TVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTVVATLRVFDADV
VPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNRNLS
ISENRTMQLVVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIG
KVCVENCQAFSGINVQYELHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAELHY
MVVATDQQTSRQAQGQLLVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGLGSPTGRCEW
RQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPRGIK
AGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHRYHKF
AHKPPIPSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKIPEDPKWEFPRKN
LVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASPSELRDLLSEFNLLKQVN
HPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDE
RALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEED
SYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNL
LKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDLAASTP
SDSLLYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGRISHAFTRF
NT seq 3390 nt   +upstreamnt  +downstreamnt
atggagatgcccaggctgctgatcagcatgctgcacaccagcatagagacaggattaaca
gcccagggcctggatatggctggcgaaaatgcagcacccccctcccaccccgagggcact
gtcatgggagcagtgttcctgatgtgtgtcctggaggagcccagcggccctgggggtgtt
ctcaactgctgctgcaggccccgccctccggacccctcagcaacctcaagcagcaaccgt
ctggtggcattgggcctctacttctcgagggatgcttactgggagaagctgtatgtggac
cagccggccggcacgcccttgctgtacgtccatgccctgcgggacgcccctgaggaggtg
cccagcttccgcctgggccagcatctctacggcacataccgcacacggctgcatgagaac
aactggatctgcatccaggaggacaccggcctcctctaccttaaccggagcctggaccat
agctcctgggagaagctcagtgtccgcaaccgcggctttcccctgctcaccgtctacctc
aaggtcttcctgtcacccacatcccttcgtgagggcgagtgccagtggccaggctgtgcc
cgcgtatacttctccttcttcaacacctcctttccagcctgcagctccctcaagccccgg
gagctctgcttcccagagacaaggccctccttccgcattcgggagaaccgacccccaggc
accttccaccagttccgcctgctgcctgtgcagttcttgtgccccaacatcagcgtggcc
tacaggctcctggagggtgagggtctgcccttccgctgcgccccggacagcctggaggtg
agcacgcgctgggccctggaccgcgagcagcgggagaagtacgagctggtggccgtgtgc
accgtgcacgccggcgcgcgcgaggaggtggtgatggtgcccttcccggtgaccgtgtac
gacgaggacgactcggcgcccaccttccccgcgggcgtcgacaccgccagcgccgtggtg
gagttcaagcggaaggaggacaccgtggtggccacgctgcgtgtcttcgatgcagacgtg
gtacctgcatcaggggagctggtgaggcggtacacaagcacgctgctccccggggacacc
tgggcccagcagaccttccgggtggagcactggcccaacgagacctcggtccaggccaac
ggcagcttcgtgcgggcgaccgtacatgactataggctggttctcaaccggaacctctcc
atctcggagaaccgcaccatgcagctggtggtgctggtcaatgactcagacttccagggc
ccaggagcgggcgtcctcttgctccacttcaacgtgtcggtgctgccggtcagcctgcat
ctgcccagtacctactccctctccgtgagcaggagggctcgccgatttgcccagatcggg
aaagtctgtgtggaaaactgccaggcgttcagtggcatcaacgtccagtacgagctgcat
tcctctggcgccaactgcagcacgctaggggtggtcacctcagccgaggacacctcgggg
atcctgtttgtgaatgacaccaaggccctgcggcggcccaagtgtgccgaacttcactac
atggtggtggccaccgaccagcagacctccagacaggcccagggccagctgcttgtaacg
gtggaggggtcatatgtggccgaggaggcgggctgccccctgtcctgtgcagtcagcaag
agacggctggagtgtgaggagtgtggcggcctgggctccccaacaggcaggtgtgagtgg
aggcaaggagatggcaaagggatcaccaggaacttctccacttgctctcccagcaccaag
acctgccccgacggccactgcgatgttgtggagacccaagacatcaacatttgccctcag
gactgcctccggggcagcattgtcgggggacacgagcctggggagccccgggggattaaa
gctggctatggcacctgcaactgcttccctgaggaggagaagtgcttctgcgagcccgaa
gacatccaggatccactgtgcgacgagctgtgccgcacagtgatcgcagccgccgtcctc
ttctccttcatcgtctcggtgctgctgtctgccttctgcatccaccgctaccacaagttt
gcccacaagccacccatcccctcagctgagatgaccttccggaggcccgcccaggccttc
ccggtcagctactcctcttccggtgcccgccggccctcgctggactccatggagaaccag
gtctctgtggatgccttcaagattccggaggatccaaagtgggaattccctcggaagaac
ttggttcttggaaaaactctaggagaaggcgaatttggaaaagtggtcaaggcaacggcc
ttccgtctgaaaggcagagcagggtacaccacggtggccgtgaagatgctgaaagagaac
gcctccccgagtgagctgcgagacctgctgtcagagttcaacctcctgaagcaggtcaac
cacccacatgtcatcaaattgtatggggcctgcagccaggatggcccgctcctcctcatc
gtggagtacgccaaatacggctccctgcggggcttcctccgcgagagccgcaaagtgggg
cctggctacctgggcagtggaggcagccgcaactccagctccctggaccacccggatgag
cgggccctcaccatgggcgacctcatctcatttgcctggcagatctcacgggggatgcag
tatctggccgagatgaagctcgttcatcgggacttggcagccagaaacatcctggtagct
gaggggcggaagatgaagatttcggatttcggcttgtcccgagatgtttatgaagaggat
tcctacgtgaagaggagcaagggtcggattccagttaaatggatggcaattgaatccctt
tttgatcatatctacaccacgcaaagtgatgtatggtcttttggtgtcctgctgtgggag
attgtgaccctagggggaaacccctatcctgggattcctcctgagcggctcttcaacctt
ctgaagaccggccaccggatggagaggccagacaactgcagcgaggagatgtaccgcctg
atgctgcaatgctggaagcaggagccggacaaaaggccggtgtttgcggacatcagcaaa
gacctggagaagatgatggttaagagcagagactacttggaccttgcggcgtccactccg
tctgactccctgctttatgacgacggcctctcagaggaggagacaccgctggtggactgt
aataatgcccccctccctcgagccctcccttccacatggattgaaaacaaactctatggt
agaatttcccatgcatttactagattctag

KEGG   Pan paniscus (bonobo): 100994282
Entry
100994282         CDS       T02283                                 

Gene name
NTRK3
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 3
  KO
K05101  neurotrophic tyrosine kinase, receptor type 3 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04722  Neurotrophin signaling pathway
pps05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100994282 (NTRK3)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100994282 (NTRK3)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100994282 (NTRK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100994282 (NTRK3)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100994282 (NTRK3)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   100994282 (NTRK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set LRRCT_2 ig Ig_3 LRR_8 Ig_2 C2-set_2 LRRNT LRR_4 LRR_5 TrkA_TMD Haspin_kinase LRR_6
Other DBs
NCBI-GeneID: 100994282
NCBI-ProteinID: XP_003820449
UniProt: A0A2R9CFI2
Position
15
AA seq 825 aa
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTISGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRVGGHTMLPI
RWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRV
CPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggatgtctctctttgcccagccaagtgtagtttctggcggattttcttgctgggaagc
gtctggctggactatgtgggctccgtgctggcttgccctgcaaattgtgtctgcagcaag
actgagatcaattgccggcggccggacgatgggaacctcttccccctcctggaagggcag
gattcagggaacagcaatgggaacgccagcatcaacatcacggacatctcaaggaatatc
acttccatacacatagagaactggcgcagtcttcacacgctcaacgccgtggacatggag
ctctacaccggacttcaaaagctgaccatcaagaactcaggacttcggagcattcagccc
agagcctttgccaagaacccccatttgcgttatataaacctgtcaagtaaccggctcacc
acactctcgtggcagcttttccagacgctgagtcttcgggaattgcagttggagcagaac
tttttcaactgcagctgtgacatccgctggatgcagctctggcaggagcagggggaggcc
aagctcaacagccagaacctctactgcatcaacgctgatggctcccagcttcctcttttc
cgcatgaacatcagtcagtgtgaccttcctgagatcagcgtgagccacgtcaacctgacc
gtacgagagggtgacaatgctgttatcacttgcaatggctctggatcaccccttcctgat
gtggactggatagtcactgggctgcagtccatcaacactcaccagaccaatctgaactgg
accaatgttcatgccatcaacttgacgctggtgaatgtgacgagtgaagacaatggcttc
accctgacgtgcattgcagagaacgtggtgggcatgagcaatgccagtgttgccctcact
gtctactatcccccacgtgtggtgagcctggaggagcctgagctgcgcctggagcactgc
atcgagtttgtggtgcgtggcaaccccccaccaacgctgcactggctgcacaatgggcag
cctctgcgggaatccaagatcatccatgtggaatactaccaagagggagagatttccgag
ggctgcctgctcttcaacaagcccacccactacaacaatggcaactataccctcattgct
aaaaacccactgggcacagccaaccagaccatcagtggccacttcctcaaggagcccttt
ccagagagcacggataactttatcttgtttgacgaagtgagtcccacacctcctatcact
gtgacccacaaaccagaagaagacacttttggggtatccatagcggttggacttgctgct
tttgcctgtgtcctgttggtggttctcttcgtcatgatcaacaaatatggtcgacggtcc
aaatttggaatgaagggtcccgtggctgtcatcagtggtgaggaggactcagccagccca
ctgcaccacatcaaccacggcatcaccacgccctcgtcgctggatgccgggcccgacact
gtggtcatcggcatgacccgcatccctgtcattgagaacccccagtacttccgtcaggga
cacaactgccacaagccggacacgtatgtgcagcacattaagaggagagacatcgtgctg
aagcgagaactgggtgagggagcctttggaaaggtcttcctggccgagtgctacaacctc
agcccgaccaaggacaagatgcttgtggctgtgaaggccctgaaggatcccaccctggct
gcccggaaggatttccagagggaggccgagctgctcaccaacctgcagcatgagcacatt
gtcaagttctatggagtgtgtggagatggggaccccctcatcatggtttttgaatacatg
aagcatggagacctgaataagttcctcagggcccatgggccagatgcaatgatccttgtg
gatggacagccacgccaggccaagggtgagctggggctctcccaaatgctccacattgcc
agtcagatcgcctcgggtatggtgtacctggcctcccagcactttgtgcaccgagacctg
gccaccaggaactgcctggttggagcgaatctgctagtgaagattggggacttcggcatg
tccagagatgtctacagcacggattattacagggtgggaggacacaccatgctccccatt
cgctggatgccccctgaaagcatcatgtaccggaagttcactacagagagtgatgtgtgg
agcttcggggtgatcctctgggagatcttcacctatggaaagcagccatggttccagctc
tcaaacacggaggtcattgagtgcattacccaaggtcgtgttttggagcggccccgagtc
tgccccaaagaggtgtacgatgtcatgctggggtgctggcagagggaaccacagcagcgg
ttgaacatcaaggagatctacaaaatcctccatgctttggggaaggccaccccaatctac
ctggacattcttggctag

KEGG   Pan paniscus (bonobo): 100994887
Entry
100994887         CDS       T02283                                 

Gene name
NTRK2
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 2
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04020  Calcium signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04722  Neurotrophin signaling pathway
pps05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100994887 (NTRK2)
   04014 Ras signaling pathway
    100994887 (NTRK2)
   04020 Calcium signaling pathway
    100994887 (NTRK2)
   04151 PI3K-Akt signaling pathway
    100994887 (NTRK2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100994887 (NTRK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    100994887 (NTRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100994887 (NTRK2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100994887 (NTRK2)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   100994887 (NTRK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 LRRCT_2 Ig_2 ig LRR_8 LRRNT V-set LRR_5 Ig_C17orf99 Haspin_kinase
Other DBs
NCBI-GeneID: 100994887
NCBI-ProteinID: XP_003809233
UniProt: A0A2R9BM51
Position
9
AA seq 822 aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL
KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
VKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQI
AAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM
PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQ
EVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtcgtcctggataaggtggcatggacccgccatggcgcggctctggggcttctgctgg
ctggttgtgggcttctggagggccgctttcgcctgtcccacgtcctgcaaatgcagtgcc
tctcggatctggtgcagcgacccttctcctggcatcgtggcatttccgagattggagcct
aacagtgtagatcctgagaacatcaccgaaattttcatcgcaaaccagaaaaggttagaa
atcatcaacgaagatgatgttgaagcttatgtgggactgagaaatctgacaattgtggat
tctggattaaaatttgtggctcataaagcatttctgaaaaacagcaacctgcagcacatc
aattttacccgaaacaaactgacgagtttgtctaggaaacatttccgtcaccttgacttg
tctgaactgatcctggtgggcaatccatttacatgctcctgtgacattatgtggatcaag
actctccaagaggctaaatccagtccagacactcaggatttgtactgcctgaatgaaagc
agcaagaatattcccctggcaaacctgcagatacccaattgtggtttgccatctgcaaat
ctggccgcacctaacctcactgtggaggaaggaaagtctatcacattatcctgtagtgtg
gcaggcgatccggttcctaacatgtattgggatgttggtaatctggtttccaaacatatg
aatgaaacaagccacacacagggctccttaaggataactaacatttcatccgatgacagt
gggaagcagatctcttgtgtggcggaaaatcttgtaggagaagatcaagattctgtcaac
ctcactgtgcattttgcaccaactatcacatttctcgaatctccaacctcagaccaccac
tggtgcattccattcactgtgaaaggcaaccccaaaccagcgcttcagtggttctataac
ggggcaatattgaatgagtccaaatacatctgtactaaaatacatgttaccaatcacacg
gagtaccacggctgcctccagctggataatcccactcacatgaacaatggggactacact
ctaatagccaagaatgagtatgggaaggatgagaaacagatttctgctcacttcatgggc
tggcctggaattgacgatggtgcaaacccaaattatcctgatgtaatttatgaagattat
ggaactgcagcgaatgacatcggggacaccacgaacagaagtaatgaaatcccttccaca
gacgtcactgataaaaccggtcgggaacatctctcggtctatgctgtggtggtgattgcg
tctgtggtgggattttgccttttggtaatgctgtttctgcttaagttggcaagacactcc
aagtttggcatgaaaggcccagcctccgttatcagcaatgatgatgactctgccagccca
ctccatcacatctccaatgggagtaacactccatcttcttcggaaggtggcccagatgct
gtcattattggaatgaccaagatccctgtcattgaaaatccccagtactttggcatcacc
aacagtcagctcaagccagacacatttgttcagcacatcaagcgacataacattgttctg
aaaagggagctaggcgaaggagcctttggaaaagtgttcctagctgaatgctataacctc
tgtcctgagcaggacaagatcttggtggcagtgaagaccctgaaggatgccagtgacaat
gcacgcaaggacttccaccgcgaggctgagctcctgaccaacctccagcacgagcacatc
gtcaagttctatggcgtctgcgtggagggcgaccccctcatcatggtctttgagtacatg
aagcacggggacctcaacaagttcctcagggcacacggtcctgatgccgtgctgatggct
gagggcaacccgcccacggaactgacacagtcgcagatgctgcatatagcccagcagatc
gccgcgggcatggtctacctggcgtcccagcacttcgtgcaccgcgacttggccaccagg
aactgcctggtcggggagaacttgctggtgaaaatcggggactttgggatgtcccgggac
gtgtacagcactgactactacagggtcggtggccacacaatgctgcccattcgctggatg
cctccagagagcatcatgtacaggaaattcacgacggaaagcgacgtctggagcctgggg
gtcgtgttgtgggagattttcacctatggcaaacagccctggtaccagctgtcaaacaat
gaggtgatagaatgtatcactcagggccgagtcctgcagcgaccccgcacgtgcccccag
gaggtgtatgagctgatgctggggtgctggcagcgagagccccacatgaggaagaacatc
aagggcatccataccctccttcagaacttggccaaggcatctcctgtctacctggacatt
ctaggctag

KEGG   Pan paniscus (bonobo): 100995426
Entry
100995426         CDS       T02283                                 

Gene name
NTRK1
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 1
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04020  Calcium signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04722  Neurotrophin signaling pathway
pps04750  Inflammatory mediator regulation of TRP channels
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05216  Thyroid cancer
pps05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100995426 (NTRK1)
   04014 Ras signaling pathway
    100995426 (NTRK1)
   04020 Calcium signaling pathway
    100995426 (NTRK1)
   04151 PI3K-Akt signaling pathway
    100995426 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100995426 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100995426 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100995426 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100995426 (NTRK1)
   05202 Transcriptional misregulation in cancer
    100995426 (NTRK1)
   05230 Central carbon metabolism in cancer
    100995426 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100995426 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100995426 (NTRK1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100995426 (NTRK1)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   100995426 (NTRK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LRRCT_2 LRR_8 I-set Ig_3 TrkA_TMD Ig_2 LRR_4
Other DBs
NCBI-GeneID: 100995426
NCBI-ProteinID: XP_003821077
UniProt: A0A2R9AZV6
Position
1
AA seq 790 aa
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPQGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPDTNSTSGDPVEKKDETPFGVSVAVGLAV
FACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGL
QGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKAL
KEVSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGP
DAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKI
GDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQ
PWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQ
APPVYLDVLG
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgctgcgaggcggacggcgcgggcagcttggctggcacagctgggctgcggggccgggc
agcctgctggcttggctgatactggcatctgcgggcgccgcaccctgccccgatgcctgc
tgcccccagggctcctcgggactgcgatgcacccgggatggggccctggatagcctccac
cacctgcccggcgcagagaacctgactgagctctacatcgagaaccagcagcatctgcag
catctggagctccgtgatctgaggggcctgggggagctgagaaacctcaccatcgtgaag
agtggtctccgtttcgtggcgccagatgccttccatttcactcctcggctcagtcgcctg
aatctctccttcaacgctctggagtctctctcctggaaaactgtgcagggcctctcctta
caggaactggtcctgtcggggaaccctctgcactgttcttgtgccctgcgctggctacag
cgctgggaggaggagggactgggcggagtgcctgaacagaagctgcagtgtcatgggcaa
gggcccctggcccacatgcccaatgccagctgtggtgtgcccacgctgaaggtccaggtg
cccaatgcctcggtggatgtgggggacgacgtgctgctgcggtgccaggtggaggggcgg
ggcctggagcaggccggctggatcctcacagagctggagcagtcagccacagtgatgaaa
tctgggggtctgccatccctggggctgaccctggccaatgtcaccagtgacctcaacagg
aagaacgtgacgtgctgggcagagaacgatgtgggccgggcagaggtctctgttcaggtc
aacgtctccttcccggccagtgtgcagctgcacacggcggtggagatgcaccactggtgc
atccccttctctgtggatgggcagccggcaccgtctctgcgctggctcttcaatggctcc
gtgctcaatgagaccagcttcatcttcactgagttcctggagccggcagccaatgagacc
gtgcggcacgggtgtctgcgcctcaaccagcccacccacgtcaacaacggcaactacacg
cttctggctgccaaccccttcggccaggcctccgcctccatcatggctgccttcatggac
aacccttttgagttcaaccccgaggaccccatccctgacactaacagcacatctggagac
ccggtggagaagaaggacgaaacaccttttggggtctcggtggctgtgggcctggctgtc
tttgcctgcctcttcctttctacgctgctccttgtgctcaacaaatgtggacggagaaac
aagtttgggatcaaccgcccggctgtgctggctccagaggatgggctggccatgtccctg
catttcatgacattgggtggcagctccctgtcccccaccgagggcaaaggctctgggctc
caaggccacatcatcgagaacccacaatacttcagtgatgcctgtgttcaccacatcaag
cgccgggacatcgtgctcaagtgggagctgggggagggcgcctttgggaaggtcttcctt
gctgagtgccacaacctcctgcctgagcaggacaagatgctggtggctgtcaaggcactg
aaggaggtgtccgagagtgctcggcaggacttccagcgtgaggctgagctgctcaccatg
ctgcagcaccagcacattgtgcgcttcttcggcgtctgcaccgagggccgccccctgctc
atggtctttgagtatatgcggcatggggacctcaaccgcttcctccgatcccatgggcct
gatgccaagctgctggctggtggggaggatgtggctccaggccccctgggtctggggcag
ctgctggccgtggctagccaggtcgctgcggggatggtgtacctggcgggtctgcatttt
gtgcaccgggacctggccacacgcaactgtctagtgggccagggactggtggtcaagatt
ggtgattttggcatgagcagggatatctacagcaccgactattaccgtgtgggaggccgc
accatgctgcccattcgctggatgccgcccgagagcatcctgtaccgtaagttcaccacc
gagagcgacgtgtggagcttcggcgtggtgctctgggagatcttcacctacggcaagcag
ccctggtaccagctctccaacacggaggcaatcgactgcatcacgcagggacgtgagttg
gagcggccacgtgcctgcccaccagaggtctacgccatcatgcggggctgctggcagcgg
gagccccagcaacgccacagcatcaaggatgtgcacgcccggctgcaagccctggcccag
gcacctcctgtctacctggatgtcctgggctag

KEGG   Pan paniscus (bonobo): 100996186
Entry
100996186         CDS       T02283                                 

Gene name
ERBB4
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 4
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04020  Calcium signaling pathway
pps04151  PI3K-Akt signaling pathway
pps05014  Amyotrophic lateral sclerosis
pps05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100996186 (ERBB4)
   04012 ErbB signaling pathway
    100996186 (ERBB4)
   04020 Calcium signaling pathway
    100996186 (ERBB4)
   04151 PI3K-Akt signaling pathway
    100996186 (ERBB4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100996186 (ERBB4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100996186 (ERBB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100996186 (ERBB4)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100996186 (ERBB4)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100996186 (ERBB4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like Haspin_kinase APH DUF3951
Other DBs
NCBI-GeneID: 100996186
NCBI-ProteinID: XP_003812551
Position
2B
AA seq 1308 aa
MPFGHVIVSTGSETSKMKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQ
QYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRI
IRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQ
DIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGP
YVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYT
YGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMS
AQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNI
QSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNS
NLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCR
RFSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFK
DGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTL
PQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTA
PNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVE
FMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWC
VQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPI
KWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPI
CTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFF
QNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFVYRDGGFAAEQGVSVP
YRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERS
PRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAED
EYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
NT seq 3927 nt   +upstreamnt  +downstreamnt
atgccgtttggacatgtaattgtcagcacgggatctgagacttccaaaatgaagccggcg
acaggactttgggtctgggtgagccttctcgtggcggcggggaccgtccagcccagcgat
tctcagtcagtgtgtgcaggaacggagaataaactgagctctctctctgacctggaacag
cagtaccgagccttgcgcaagtactatgaaaactgtgaggttgtcatgggcaacctggag
ataaccagcattgagcacaaccgggacctctccttcctgcggtctgttcgagaagtcaca
ggctacgtgttagtggctcttaatcagtttcgttacctgcctctggagaatttacgcatt
attcgtgggacaaaactttatgaggatcgatatgccttggcaatatttttaaactacaga
aaagatggaaactttggacttcaagaacttggattaaagaacttgacagaaatcctaaat
ggtggagtctatgtagaccagaacaaattcctttgttacgcagacaccattcattggcaa
gatattgttcggaacccatggccttccaacttgactctcgtgtcaacaaatggtagttca
ggatgtggacgttgccataagtcctgtactggccgttgctggggacccacagaaaatcat
tgccagactttgacaaggacggtgtgtgcagaacaatgtgacggcagatgctacggacct
tacgtcagtgactgctgccatcgagaatgtgctggaggctgctcaggacctaaggacaca
gactgctttgcctgcatgaatttcaatgacagtggagcatgtgttactcagtgtccccaa
acctttgtctacaatccaaccacttttcaactggagcacaatttcaatgcaaagtacaca
tatggagcattctgtgtcaagaaatgtccacataactttgtggtagattccagttcttgt
gtgcgtgcctgccctagttccaagatggaagtagaagaaaatgggattaaaatgtgtaaa
ccttgcactgacatttgcccaaaagcttgtgatggcattggcacaggatcattgatgtca
gctcagactgtggattccagtaacattgacaaattcataaactgtaccaagatcaatggg
aatttgatctttctagtcactggtattcatggggacccttacaatgcaattgaagccata
gacccagagaaactgaatgtctttcggacagtcagagagataacaggtttcctgaacata
cagtcatggccaccaaacatgactgacttcagtgttttttctaacctggtgaccattggt
ggaagagtactctatagtggcctgtccttgcttatcctcaagcaacagggcatcacctct
ctacagttccagtccctgaaggaaatcagcgcaggaaacatctatattactgacaacagc
aacctgtgttattatcataccattaactggacaacactcttcagcacaatcaaccaaaga
atagtaatccgggacaatagaaaagctgaaaattgtactgctgaaggaatggtgtgcaac
catctgtgttccagtgatggctgttggggacctgggccagaccaatgtctgtcgtgtcgc
cgcttcagtagaggaaggatctgcatagagtcttgtaacctctatgatggtgaatttcgg
gagtttgagaatggctccatctgtgtggagtgtgacccccagtgtgagaagatggaagat
ggcctcctcacatgccatggaccgggtcctgacaactgtacgaagtgctctcattttaaa
gatggcccaaactgtgtggaaaaatgtccagatggcttacagggggcaaacagtttcatt
ttcaagtatgctgatccagatcgggagtgccacccatgccatccaaactgcacccaaggg
tgtaacggtcctactagtcatgactgcatttactacccatggacgggccattccacttta
ccacaacatgctagaactcccctgattgcagctggagtaattggtgggctcttcattctg
gtcattgtgggtctgacatttgctgtttatgttagaaggaagagcatcaaaaagaaaaga
gccttgagaagattcttggaaacagagttggtggaaccattaactcccagtggcacagca
cccaatcaagctcaacttcgtattttgaaagaaactgagctgaagagggtgaaagtcctt
ggctcaggtgcttttggaacggtttataaaggtatttgggtacctgaaggagaaactgtg
aagattcctgtggctattaagattcttaatgagacaactggtcccaaggcaaatgtggag
ttcatggatgaagctctgatcatggcaagtatggatcatccacacctagtccggttgctg
ggtgtgtgtctgagcccaaccatccagctggttactcaacttatgccccatggctgcctg
ttggagtatgtccacgagcacaaggataacattggatcacaactgctgcttaactggtgt
gtccagatagctaagggaatgatgtacctggaagaaagacgactcgttcatcgggatttg
gcagcccgtaatgtcttagtgaaatctccaaaccatgtgaaaatcacagattttgggcta
gccagactcttggaaggagatgaaaaagagtacaatgctgatggaggaaagatgccaatt
aaatggatggctctggagtgtatacattacaggaaattcacccatcagagtgacgtttgg
agctatggagttactatatgggaactgatgacctttggaggaaaaccctatgatggaatt
ccaacgcgagaaatccctgatttattagagaaaggagaacgtttgcctcagcctcccatc
tgcactattgacgtttacatggtcatggtcaaatgttggatgattgatgctgacagtaga
cctaaatttaaggaactggctgctgagttttcaaggatggctcgagaccctcaaagatac
ctagttattcagggtgatgatcgtatgaagcttcccagtccaaatgacagcaagttcttt
cagaatctcttggatgaagaggatttggaagatatgatggatgctgaggagtacttggtc
cctcaggctttcaacatcccacctcccatctatacttccagagcaagaattgactcgaat
aggaaccagtttgtataccgagatggaggttttgctgctgaacaaggagtgtctgtgccc
tacagagccccaactagcacaattccagaagctcctgtggcacagggtgctactgctgag
atttttgatgactcctgctgtaatggcaccctacgcaagccagtggcaccccatgtccaa
gaggacagtagcacccagaggtacagtgctgaccccactgtgtttgccccagaacggagc
ccacgaggagagctggatgaggaaggttacatgactcctatgcgagacaaacccaaacaa
gaatacctgaatccagtggaggagaacccttttgtttctcggagaaaaaatggagacctt
caagcattggataatcccgaatatcacaatgcatccaatggcccacccaaggccgaggat
gagtatgtgaacgagccactgtacctcaacacctttgccaacaccttgggaaaagctgag
tacctgaagaacaacatactgtcaatgccagagaaggccaagaaagcgtttgacaaccct
gactactggaaccacagcctgccacctcggagcacccttcagcacccagactacctgcag
gagtacagcacaaaatatttttataaacagaatgggcggatccggcctattgtggcagag
aatcctgaatacctctctgagttctccctgaagccaggcactgtgctgccgcctccacct
tacagacaccggaatactgtggtgtaa

DBGET integrated database retrieval system