KEGG   Pan paniscus (bonobo): 100969544
Entry
100969544         CDS       T02283                                 

Gene name
RYR3
Definition
(RefSeq) ryanodine receptor 3
  KO
K04963  ryanodine receptor 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04371  Apelin signaling pathway
pps04713  Circadian entrainment
pps04921  Oxytocin signaling pathway
pps04970  Salivary secretion
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100969544 (RYR3)
   04020 Calcium signaling pathway
    100969544 (RYR3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100969544 (RYR3)
  09154 Digestive system
   04970 Salivary secretion
    100969544 (RYR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100969544 (RYR3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100969544 (RYR3)
   05012 Parkinson disease
    100969544 (RYR3)
   05020 Prion disease
    100969544 (RYR3)
   05022 Pathways of neurodegeneration - multiple diseases
    100969544 (RYR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100969544 (RYR3)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Ryanodine receptor
   100969544 (RYR3)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 100969544
NCBI-ProteinID: XP_014203240
Position
15
AA seq 4869 aa
MAEGGEGGEDEIQFLRTEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAVLLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSVSNGNIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPPTD
QNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRAKSDTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHIAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQ
FVSGNNRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNIYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDI
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKW
YFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGIRDLLGT
TQFLSQASFIPCPVDTSQVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAVEKVSIDKIRFFRVERSY
AVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGNRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGR
MNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVMRID
GTMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVASSQRSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPN
TKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFRSEEKNPVPQCPPRLDVQTIQPVLW
SRMPNSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYH
TLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLANAKE
RKLMMKNEYIIPITSTTRNIRLFPDESKRHGLPGVGLRTCLKPGFRFSTPCFVVTGEDHQ
KQSPEIPLESLRTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDD
DDVRQILLLIDPSVFGEHSAGTEEGAEKEEVTQVEEKAVEAGEKAGKEAPVKGLLQTRLP
ESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTA
RKTKEFRSPPQEQINMLLNFQLGENCPCPEEIREELYDFHEDLLLHCGVPLEEEEEEEED
TSWTGKLCALVYKIKGPPKPEKEQPTEEEERCPTTLKELISQTMICWAQEDQIQDSELVR
MMFNLLRRQYDSIGELLQALRKTYTISHTSVSDTVNLLAALGQIRSLLSVRMGKEEELLM
INGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGTEKSQIAFPKMVASCCRFLCYF
CRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALSLEEPDLE
KVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKL
LIRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGYKREVTEDDEEEEEIVHM
GNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPS
LNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDT
VSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIYRLSKGRSLTKA
QRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCLP
SGWGSYGLAVEEELHLTEKIFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYLDTR
ITATLEKQISVDADGNFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYG
ISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQREN
EKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGG
SHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGIIVSRGMKDMELDASSMEKRFAYKFL
KKILKYVDSAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHCLYFLSS
PLKPLSSSGYASHKEKEMVASLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTV
MKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPIL
TSIFEHVTQHQFGMDLLLGDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLAAA
IPVAFLEPTLNRYNPLSVFNTKTPRERSILGMPDTVEDMCPDIPQLEGLMKEINDLAESG
ARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPSTGPCCTKVTSEHLSLILGNILKIIN
NNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLKADGK
GDTQEAELLILDEFAVLCRDLYAFYPMLLRYVDNNRSNWLKSPDADSDQLFRMVAEVFIL
WCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLYS
IQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSHRDTDEEVREHLRNNLHLQEKSD
DPAVKWQLNLYKNVLKSEEPFNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLSK
QRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKSPKVEEE
EEEETEKQPDPLHQIILYFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEDEDKE
KTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNA
GVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRER
GEKVLQNDEFTCDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQESI
SDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVV
GFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVE
SSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKKEFQKAMEGQKQYTQSEIDF
LLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESV
LNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEK
MELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASA
FAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELVKVLFSFFWMLFVGLFQLLFT
ILGGIFQILWSTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDTMEAERAEVMEPGIT
TELVHFIKGEKGDTDIMSDLFGLHPKKEGSLKHGPEVGLGDLSEIIGKDEPPTLESTVQK
KRKAQAAEMKAANEAEGKVESEKADMEDGEKEDKDKEEEQAEYLWTEVTKKKKRRCGQKV
EKPEAFTANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEE
TEDVANLWNSFNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKVP
LVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINK
YGDLYGAERIAELLGLDKNALDFSPVEETKAEAASLVSWLSSIDMKYHIWKLGVVFTDNS
FLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVV
YLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDP
YEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYF
DTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCF
RKQYEDQLG
NT seq 14610 nt   +upstreamnt  +downstreamnt
atggccgaagggggagaaggaggcgaggacgagatccagtttctgaggactgaggatgaa
gtggtactccagtgcatcgccaccattcataaggagcagaggaagttctgcctggcagcc
gagggacttgggaatcgcctgtgcttcttggaacccacttcagaagccaagtacattcct
ccagatctctgcgtctgcaattttgtgctggaacagtccctatctgtcagagccctgcag
gaaatgcttgccaacacaggtgaaaatggcggcgaaggggcagcacaaggaggtggccac
aggaccctgttatacggccatgcagttctcctgaggcactctttcagcggaatgtatcta
acatgcttgactacatcaagatcccagacagacaaacttgcctttgatgtaggtctacgg
gaacatgccacaggagaagcctgttggtggactatacatcctgcttccaaacagaggtcc
gaaggagagaaagttcgaattggcgatgacctcatcctcgtcagcgtgtcctctgaaaga
taccttcatctctcagtatcaaatggtaacatacaagtggatgcctcctttatgcaaaca
ctctggaatgtacatcctacgtgctcaggaagtagcatcgaagaaggatacctacttggt
gggcatgtagtacgtcttttccatggtcatgatgaatgtttgacgataccacctacagac
cagaatgattcccagcacaggaggatattctacgaagctgggggagctgggactcgagcc
aggtctctgtggagagtggaaccccttcggataagctggagtggcagtaacatcagatgg
ggccaggctttccgactccggcatctcaccacaggccactacctggccttgacagaagac
caaggccttatactgcaagaccgggcaaagtcagacaccaagtccacagctttctctttc
cgggcatcaaaggaactcaaggagaaattagactccagtcacaagcgagacatagaaggc
atgggagttccagaaatcaagtatggagattctgtctgctttgtgcagcatatagccagt
ggtctgtgggtgacctacaaagcacaagacgccaaaacttcccgcctgggacctctaaaa
agaaaggtcatactccatcaggaaggccacatggatgatggattaacactgcagagatgc
cagcgtgaggagtcccaggctgctcggatcatccggaacactacagccttattcagccag
tttgtcagcggaaacaatcgcacagctgcccccatcaccctgcctatagaagaagtcctg
cagaccctacaggacttgatcgcctacttccagcccccggaggaggagatgcgacatgaa
gacaagcagaacaagctccgctcactcaaaaacagacaaaatcttttcaaggaagaggga
atgttggcccttgtcttaaattgcattgaccgcttaaatatctacaatagcgtagcacac
tttgcagggattgcaagggaagagagtggcatggcctggaaagaaattctgaacctcctc
tacaaattgctggctgctctcattcgtggaaacagaaacaattgcgctcaattctccaat
aaccttgattggctcatcagtaaattggacagactagaatcttcctcaggtatcttggaa
gttttgcactgcatcttaactgaaagcccagaagccttaaatctgatagcagagggccac
atcaagtccatcatctccctgttggataagcacgggcggaatcacaaggttctggatatc
ctgtgctccctctgtctctgcaatggggttgcagtgagagccaaccagaatctgatctgt
gacaacttgctgccccggagaaacctactcctgcagacacgactgattaacgatgtaacc
agtatccggccaaacatcttcctgggagttgcggagggctcagcccagtacaagaagtgg
tacttcgagctgattatcgaccaggtggaccccttcctaacagcagagcccacacatctg
cgggtgggctgggcctcttcttcaggctatgccccatacccaggaggtggagaaggatgg
ggaggcaatggtgttggtgatgacctgtactcctatggctttgatggacttcacctttgg
tcaggccggatacccagagctgtggcttccatcaaccagcacctcctgagatcggatgac
gtggtaagctgctgcctggacctcggggtgcccagcatctcattccgcatcaatgggcaa
cccgtgcaggggatgtttgagaacttcaacacagacgggctcttcttccctgtgatgagc
ttttcagcaggtgtcaaagtacgtttccttatgggtggacgtcatggagagtttaagttc
ctgcctccctctggctatgccccttgctatgaagccttacttccaaaagagaagatgaga
ttggagcctgtcaaagaatataaacgtgatgctgatggcattagagatctcttgggtacc
acccagttcctctcccaagcctctttcatcccatgccccgtagacaccagtcaggttgtt
ttgccacctcacctagaaaagatccgagacagactagctgaaaacatccatgagctttgg
ggaatgaataaaatagaacttggctggactttcggcaagatacgagatgacaataaaaga
caacacccttgccttgtggagttttcaaagctccccgaaactgagaagaattataacctg
caaatgtcaactgaaaccttaaaaaccctcctggccctggggtgccacattgctcatgtt
aatccagctgctgaggaggatctcaagaaggtcaaactgcccaaaaactatatgatgtcc
aacggctataagccagcccctttggatttgtctgatgtgaagctgttacctcctcaagaa
attttagtggataagcttgcagaaaatgcacacaatgtttgggcaaaagacagaataaaa
caaggatggacctatggcatccaacaggatttgaagaacaaaagaaatccccgtctggtg
ccatatgcattactggatgagcgtaccaagaagtcaaacagggacagcctgcgggaagct
gtgcgcacttttgttggttacgggtataacattgaaccatcagaccaagaactagctgac
tcggctgtggagaaggtcagcatagacaagatccgatttttccgggtagagcgatcttac
gcagtgagatctggaaagtggtattttgagtttgaggtggtgactggaggagacatgcga
gtcggctgggccaggccaggctgtcggcctgatgtcgagctgggggccgatgaccaagcc
tttgtgtttgaaggcaacaggggccagcgttggcatcaaggaagtgggtattttgggcgt
acctggcagccaggggatgtggtcggatgtatgattaacctggatgatgcttcaatgatc
ttcacactgaatggggagctgctgatcaccaacaaaggctctgaacttgccttcgctgac
tacgagattgagaatggcttcgtgcccatctgctgtctggggctatctcagattggccgc
atgaatctcgggacagatgccagtaccttcaagttttataccatgtgcggtctccaagag
ggctttgagccttttgctgtcaacatgaacagagatgttgctatgtggttcagcaagcgc
ctcccgacgtttgtcaacgtgccaaaggatcatccacacatagaggtcatgaggattgat
ggcaccatggacagccctccgtgtctcaaggtgacccataagacatttggcacacagaat
agcaatgccgacatgatctattgccgcttgagcatgccggtcgagtgccactcctccttc
agccacagcccctgtctggacagtgaagctttccagaaaaggaaacagatgcaagaaata
ctctctcatacaacaacacagtgctactatgccatccgcatctttgctggacaggatcca
tcctgtgtctgggtcggatgggtgactccagactatcacttgtacagtgaaaagtttgac
ctgaataaaaactgcacagtgactgtcaccctaggggatgaaagaggccgggtccatgaa
agtgtgaagcgcagcaactgctacatggtctggggtggggacattgtagccagttcccag
agatcaaatcggagcaatgtggacctggagatcggctgtctcgtggatctggccatgggc
atgttgtccttctcagccaatggaaaggaactgggcacctgctaccaggtggagcctaat
accaaagtgtttccagcagtcttcctgcagcctacaagtacttctttgtttcagtttgaa
cttggaaagctgaagaatgcaatgcccctgtcagcggccatattcaggagtgaagagaag
aacccagtcccacagtgtccacctcggctggatgtccaaaccatccagcccgtgctctgg
agccgtatgcccaacagcttcctgaaggtagagaccgagcgtgtgagcgagcgccacggc
tgggtggtgcagtgcctggagcccctgcagatgatggcgctccacatccccgaggagaac
aggtgtgtggatatcctggagctctgtgagcaggaggacctgatgcggttccattaccac
acgctgaggctctacagcgcggtgtgcgccctgggaaacagccgcgtggcctacgccctg
tgcagccacgtggacctctcccagctcttctatgccattgacaacaagtacctccccggc
ctccttcgatctggtttctatgacctgctcatcagcatccacctggccaacgccaaggag
aggaagctgatgatgaagaacgagtacatcatccccattaccagcaccaccaggaatatc
cgcctcttcccggacgagtccaagaggcatggactgcctggggtgggcctgagaacatgt
ctcaagcccgggttcaggttctccaccccttgctttgttgtgactggtgaggatcaccaa
aagcagagccccgagattcccttggagagtctcaggacgaaggctctgagtatgctgaca
gaggcagtgcagtgcagcggggcccacatccgagaccccgtagggggttctgtggagttc
cagtttgtgcctgtgctgaaactcattggaaccctgctggtcatgggcgtgtttgatgat
gatgatgttcggcagatcctcctcctgattgatccctctgtgtttggggagcatagtgcg
gggacagaggagggagcagaaaaggaggaagtgacccaggtggaggagaaggctgtggag
gctggggagaaggccggcaaggaggctcctgtcaaaggcttgttgcagactcgattaccc
gaatctgtcaagctgcagatgtgtgagctcctcagctatctctgcgactgtgagctgcag
caccgagtggaggccattgtggcatttggtgacatttatgtctccaagctgcaggcaaat
cagaagttccgctacaatgagctcatgcaggccctgaacatgtctgcggccctgactgcc
cggaagaccaaggagttccgctcacccccacaggagcagatcaacatgctacttaacttt
caactgggagagaactgcccctgcccagaggagattcgggaggagctgtatgatttccat
gaggaccttctccttcactgtggggttcctttggaagaagaggaagaggaggaggaggac
acctcctggacaggaaaactctgtgccttggtttacaaaatcaaaggcccacccaagcca
gagaaggagcagccgacggaggaggaggagagatgccccacaacattgaaggaactcatc
tcacagacgatgatctgctgggcccaggaggaccagatccaggattcagagctggtccga
atgatgttcaacctcctccggaggcagtatgacagcatcggggagctgctgcaggcactg
cggaagacctacaccatcagccacacctctgtaagcgacaccgtcaacctgctggctgcc
ctgggccaaatccgctccctcctcagtgtcaggatgggcaaggaagaggagttgctcatg
atcaatgggctgggagacataatgaacaacaaggtgttttaccagcatcccaacctcatg
agagtcctgggcatgcacgagacggtgatggaggtgatggtgaacgtgttgggtacagag
aaatctcagattgcatttccaaagatggttgctagctgctgccgtttcctttgctatttc
tgtcgaattagccggcaaaatcagaaggccatgtttgagcatctgagttatcttctggag
aatagcagtgttggcctagcttccccgtcgatgaggggatccaccccactggatgtggca
gcttcctctgtgatggacaacaatgagttagcgctgagcttagaggaaccagacctcgag
aaggtggtgacctacttggcaggctgtggcctacagagctgccccatgcttctggccaaa
ggataccctgatgtcggctggaaccccattgaaggggaacgctacctgtccttcctgagg
tttgctgtcttcgtgaacagtgagagtgtggaagaaaacgccagcgttgtggtcaagctg
ctcatcagacgcccagagtgcttcggcccggccctgcggggtgaggggggaaacgggctc
ttggcggccatgcagggtgccattaagatctctgagaacccagcgctcgacctcccctct
caaggatacaaaagagaagtcacggaggacgatgaagaggaagaagaaatcgtgcatatg
ggcaatgcaatcatgtcattttattcggcccttatagatctactgggccgctgtgctcct
gaaatgcacctcatccagacaggaaagggggaagccatccgcatcaggtccatcctgcgc
tccctggtccccacagaagacctggttgggatcatcagcatccccttgaaactgccctcc
ctcaacaaagatgggtcggtcagtgagccagatatggcggccaacttctgccctgaccac
aaggcacctatggtgctgttcttggaccgcgtttatggcattaaggatcaaacttttctg
ctccacttgctggaggttggatttttacctgacctaagagcttctgcctctctagataca
gtttccctaagcaccacagaggctgcgcttgcactaaataggtatatatgttctgctgtg
ctcccgctcctcacaagatgtgcccctctctttgccggaacagaacactgcacctctctg
attgattccacactgcagacaatatacaggctatccaagggacgttccctcaccaaagca
caaagggacactatagaagaatgtttgcttgccatttgcaatcacttgaggccttccatg
ttacagcaactcctgcgacgcctcgtttttgatgtgccgcaactcaatgaatactgcaaa
atgcctctcaagcttctgacgaatcactatgaacagtgttggaagtattactgcctgcct
tcaggatgggggagctacgggctagctgtggaagaagagctgcacctaacggagaagatt
ttctgggggatttttgactcgctgtcccataagaaatatgacccagatcttttccgaatg
gccctgccttgtctcagtgctatagctggggccttgccaccagattatttagataccaga
atcacagccacattggagaaacagatctcagtggatgcagatggcaactttgacccaaaa
cctatcaacaccatgaatttttccttgcctgaaaaattggaatacatcgtcaccaagtat
gctgagcattcacatgataaatgggcctgtgacaagagtcagagtggatggaaatatggg
atttccctggatgaaaatgtgaagacccacccactgataaggcctttcaagacattaacg
gagaaggagaaggaaatttatcgctggcctgcccgagagtccctgaaaaccatgctggct
gtgggctggactgtggagaggaccaaagagggagaagctttggttcaacagcgggaaaat
gagaagcttcgaagtgtgtcccaggccaaccagggcaacagctacagtcctgctcccctc
gacctctcaaacgttgtgctctccagagagctccagggaatggtggaggtcgtggctgag
aactatcacaatatctgggccaagaagaagaagctggagctggagagcaaaggtggtggc
agtcaccctcttctggtaccatatgacaccttgactgccaaggaaaagttcaaggaccgg
gagaaggcacaggacctgtttaagttcctccaagtgaatggcatcatagtttccaggggt
atgaaggatatggagctggatgcctcctccatggagaagaggtttgcctataagttcttg
aagaagatcctgaaatacgttgattctgctcaagaatttattgcccatttagaagccatt
gtcagcagtgggaaaactgaaaagtctccccatgaccaggagatcaaattctttgccaaa
gttctcctcccgctggttgaccagtacttcaccaatcattgcctctacttcttgtcatcc
cctctgaagccccttagcagcagcggatatgcctcccataaggagaaagaaatggtggcc
agcctgttctgcaaacttgccgcccttgttagacacagaatttccctctttggtagtgat
tctactacaatggtgagctgtcttcacatcttagctcagacacttgacacaaggactgtc
atgaagtcaggctcagagctggtgaaggctgggttacgagcattctttgaaaatgctgca
gaagatttggagaagacttcagaaaacctgaaacttgggaagttcacccattcccgaacg
cagattaaaggcgtttctcagaatattaactacactacagtggctctgctccccatcctg
acgtccatctttgagcacgtcactcagcatcagtttggaatggatctactcttgggtgat
gtgcagatttcatgctaccacatactgtgcagcctctactcccttgggacgggaaagaac
atttatgttgaaaggcaacgccctgcccttggagaatgtcttgcctcgctggcagctgcc
ataccagtggcattcctggagcccacccttaatcgctacaatccactctcggtcttcaac
accaaaacccccagggagaggtctattctggggatgccagacacggtagaagacatgtgt
cctgacatcccccagctggaaggcctgatgaaggaaatcaacgacctggccgagtcaggg
gcccggtacacagagatgccccatgtcatcgaggtgatcttacccatgctctgcaactac
ctgtcctactggtgggagcgggggcctgagaacctgccccccagcacagggccatgctgc
accaaggtcacctctgaacacctcagtctcatcctgggcaacattctgaaaatcatcaac
aacaacctgggcatcgatgaggcctcctggatgaagcgcattgcagtgtatgcacagccc
atcatcagcaaagccaggcccgacctgctgagaagccacttcatcccaactctggagaag
ctgaagaaaaaggccgtcaagacggtgcaggaggaggagcagttgaaagccgatggcaaa
ggggacacccaggaggcagaactcctcatcctggacgagttcgcggtcctctgcagagat
ctctatgccttctaccccatgctgctccgctacgtggacaacaacagatctaactggctg
aagagtcctgatgctgattctgaccagctcttccgcatggtggcagaagtcttcattctg
tggtgtaaatctcataacttcaagagggaagagcaaaattttgtgattcagaatgaaatt
aataatttggcatttttaactggagacagcaaaagcaagatgtcaaaagccatgcaagta
aagtctggaggacaagaccaggagcggaagaagacaaagcggcggggagacttgtattcc
atccagacctccctcatcgtggctgcactcaagaaaatgctgcccattggtttgaatatg
tgtactccaggcgaccaggagctgatctccctcgcaaaatcacgatacagccatagggac
acagatgaagaggtcagagaacatctgcggaacaacttgcacttgcaggaaaagtctgat
gacccagctgtaaaatggcaactgaacctctacaagaatgttctgaagagtgaagaacct
ttcaatccggaaaagacagtggagcgtgtgcagagaatttcagcagctgtcttccacctg
gaacaggtggaacagcctttgaggtccaagaaggccgtctggcacaaactgttatcaaag
caacggaaacgggcagtggtggcctgtttcaggatggcccctctctacaacctgcccagg
caccgctctattaacctcttcctccatggctatcagagattttggatagaaacagaggag
tattcctttgaagagaaactagtacaggatttggctaaatctccaaaggtggaagaggag
gaggaggaagagacagaaaaacaacctgacccactacatcagatcattctctattttagc
cgcaacgctctcacggagaggagcaaattggaagacgaccctttgtacacctcctattcc
agcatgatggccaagagttgtcaaagtggtgaggatgaagaagaagatgaagacaaggaa
aaaacatttgaagagaaagagatggagaagcaaaaaaccctctatcagcaagctcggctg
catgagcgtggtgctgcggagatggtccttcagatgataagcgctagcaaaggtgagatg
agccccatggtggttgagacgctgaagctggggatcgccattctgaacggaggcaatgct
ggtgtgcaacagaaaatgctagattacctaaaggagaaaaaggatgctggattctttcaa
agcctttctggtcttatgcagtcttgcagtgtccttgatttgaatgcatttgagaggcag
aataaagctgaaggcctggggatggtgactgaagaaggaacactcattgttcgtgaacgt
ggtgaaaaagtactccagaatgacgagttcacgtgtgatctctttagattcctacagtta
ctttgtgaaggacataacagtgactttcagaacttcctgcggactcagatgggcaacacc
accaccgtgaatgtcatcatcagcactgtggactaccttctgcgtctgcaggaatcaatc
agtgatttctactggtattattcagggaaggacatcattgatgaatctggacagcacaat
ttttcgaaagctctggcagtcaccaagcagattttcaattctcttacagaatacatccag
ggcccttgcattggcaatcaacagagcctggctcacagcaggctgtgggacgcagtggtt
ggcttcctccatgtctttgctaatatgcagatgaaactctctcaggattccagtcagatc
gagctgctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtccctc
ctggaagggaatgtggtaaatggcaccattggcaagcagatggttgacacactggtagaa
tcatctaccaatgtagaaatgatcttgaaattctttgacatgttcttgaaacttaaagac
ttaaccagctcagacaccttcaaagaatatgacccagatggtaaaggaattatctccaaa
aaagaattccagaaggccatggaagggcaaaaacagtacacgcagtcagagattgacttt
ctcctgtcgtgtgcagaagctgatgagaatgacatgtttaattacgttgattttgtagac
cggttccatgagccagccaaggacatagggtttaatgtggctgtgttattgacaaatctt
tctgaacacatgccaaacgattcccgcctgaagtgtctgttggacccagcagaaagtgtg
ctaaattacttcgaaccctacctaggacgcatcgagatcatgggtggggccaagaagatt
gagcgtgtttattttgagatcagtgaatccagtcgcactcagtgggagaagccccaggtg
aaggaatctaagcgacagttcatttttgatgttgtcaatgaaggtggggaacaggaaaag
atggagctgtttgtgaacttctgtgaggacaccatctttgaaatgcagttagcatctcag
atctctgaatccgattcagctgacaggccagaagaggaggaagaagatgaagattcttct
tacgtgttagaaattgcgggtgaagaggaagaagacgggtctcttgagccggcctctgca
tttgctatggcctgtgcctctgtgaagaggaatgtcaccgacttcctgaagagagcaacc
ctgaagaacctcaggaagcagtacaggaacgtgaaaaagatgactgcgaaggagctggtg
aaggtgctcttctcctttttctggatgctgttcgtggggctattccagttgctcttcacc
atcctgggaggaatctttcagatcctctggagcacagtgtttggagggggcctggtagaa
ggggcaaagaacatcagagtgaccaagatcctgggtgacatgcctgacccaacccaattt
ggtatccatgatgacactatggaggctgagagggcagaggtgatggagccaggtatcacc
actgaactagtacacttcataaagggggagaagggagatacagatatcatgtcagacctc
tttggactccacccaaagaaagagggcagcttaaagcatgggcctgaagtgggtttgggt
gacctctcagaaattattggcaaggatgaaccccctacattagagagtactgtacagaag
aagaggaaagctcaggcagcagaaatgaaagcagcaaatgaagcagaaggaaaagtagaa
tccgagaaggcagacatggaagatggagagaaggaagacaaagacaaagaagaggagcaa
gctgagtacctgtggacagaagtgacaaaaaagaagaagcggcggtgtggtcagaaggtt
gagaagccggaagctttcacagccaatttctttaaagggctggaaatctatcagaccaag
ttactgcattacctggccaggaatttctacaacctgaggttccttgctctgtttgtagcc
ttcgctatcaacttcatcctgcttttttataaggtcactgaagagcctttagaagaagag
acagaggatgttgcaaacctatggaattcctttaatgacgaggaagaggaagaagcgatg
gtattctttgtccttcaggagagcaccgggtatatggcaccaacgctgcgggccctggcc
atcatccacaccatcatctctctagtctgtgtggtgggctactactgcctgaaggtgcct
ttggtggttttcaaaagggaaaaagaaatcgccaggaagctggagtttgatggcctatat
atcaccgaacagccatctgaagatgacatcaaggggcagtgggaccgcttggtgatcaac
acaccatcttttcctaataactactgggacaagtttgtaaagagaaaggtgatcaacaag
tatggagatctctacggagcagaacgcattgctgaacttctgggtttggacaaaaatgct
cttgactttagcccagtagaagagaccaaagcagaagcggcttctctggtgtcatggcta
agttccatagacatgaagtaccatatctggaagcttggagttgtttttactgacaactcc
tttctctaccttgcctggtatacaaccatgtcagtcctgggccactacaataacttcttc
tttgctgctcacctattggacatcgcaatgggcttcaagacactgaggaccattctgtca
tctgtaactcacaatggcaaacagttggttctgactgtcggtctcctggccgtggtggtt
tatctctatactgtggtggctttcaacttcttccgcaagttctacaacaaaagcgaagac
gatgacgagcccgatatgaagtgcgacgacatgatgacgtgttaccttttccacatgtac
gtgggagtgagagcaggaggtggcattggtgatgaaattgaagaccctgctggtgatcct
tatgaaatgtatcgcattgtctttgacattacctttttcttctttgtcattgtcatcctg
ctggccatcattcaaggtcttattattgatgctttcggagagctaagagaccagcaggaa
caagtgcgagaagatatggagactaaatgtttcatctgtgggattggcaatgactacttt
gacacgacccctcatggttttgaaacacatacattacaagagcacaacttagccaactac
ttgttctttctgatgtatttgattaataaagatgaaacagagcacacgggtcaggaatct
tatgtctggaagatgtaccaagaaaggtgttgggatttcttcccagccggtgactgcttt
cgtaaacaatatgaagatcagcttggataa

KEGG   Pan paniscus (bonobo): 100974705
Entry
100974705         CDS       T02283                                 

Gene name
RYR2
Definition
(RefSeq) ryanodine receptor 2
  KO
K04962  ryanodine receptor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04260  Cardiac muscle contraction
pps04261  Adrenergic signaling in cardiomyocytes
pps04371  Apelin signaling pathway
pps04713  Circadian entrainment
pps04911  Insulin secretion
pps04921  Oxytocin signaling pathway
pps04972  Pancreatic secretion
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100974705 (RYR2)
   04020 Calcium signaling pathway
    100974705 (RYR2)
   04024 cAMP signaling pathway
    100974705 (RYR2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100974705 (RYR2)
   04921 Oxytocin signaling pathway
    100974705 (RYR2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100974705 (RYR2)
   04261 Adrenergic signaling in cardiomyocytes
    100974705 (RYR2)
  09154 Digestive system
   04972 Pancreatic secretion
    100974705 (RYR2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100974705 (RYR2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100974705 (RYR2)
   05022 Pathways of neurodegeneration - multiple diseases
    100974705 (RYR2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100974705 (RYR2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100974705 (RYR2)
   05414 Dilated cardiomyopathy
    100974705 (RYR2)
   05415 Diabetic cardiomyopathy
    100974705 (RYR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100974705 (RYR2)
   04990 Domain-containing proteins not elsewhere classified [BR:pps04990]
    100974705 (RYR2)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Ryanodine receptor
   100974705 (RYR2)
Domain-containing proteins not elsewhere classified [BR:pps04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100974705 (RYR2)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 100974705
NCBI-ProteinID: XP_014198911
Position
1
AA seq 4984 aa
MGAEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDL
SICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAILLR
HSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLI
LVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMD
ECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTT
GKYLSLMEDKNLLLMDKEKADVKSTALTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSVCY
IQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIRST
VFLFNRFIRGLDALSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRAL
KNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIR
GNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLD
KHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLG
VSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDL
FSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENF
NIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQ
ERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGW
QYGPVRDDNKRQHPCLVEFCKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEDKVK
KMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQ
DVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSGTG
ERFRIFRAEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGFKA
QRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFI
PVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVP
SNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFSKTVAGGL
PGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPS
RLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPANVW
VGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNN
NGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKN
VMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCL
DPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDE
PQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFPDE
NKKHGLPGIGLSTSLRPRMQFSSPSFVSISNECYQYSPEFPLDILKSKTIQMLTEAVKEG
SLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAATPEEESD
TLEKELSVDDAKLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRI
EAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDD
KSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLKKK
QAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRAL
PKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLM
RALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLL
ENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVS
KGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNG
LLAAMEEAIKIAEDPSRDGPSPNSGSSKTLDTEEEEDDTIHMGNAIMTFYSALIDLLGRC
APEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGFCP
DHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCT
AVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRP
SMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSR
KLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFN
PQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKL
LSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYS
PRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAKEK
AKDREKAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILE
FDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKE
MVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAFLD
NAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLI
LEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNIYS
IYNTKSSRERAALSLPTNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPML
CSYMSRWWEHGPENNPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVF
SQPIINKVKPQLLKTHFLPLMEKLKKKAATVVSEEDHLKAEARGDMSEAELLILDEFTTL
ARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQ
NEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICA
PGDQELIALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTDDTS
DPEKTVERVLDIANVLFHLEQKSKRVGRRHYCLVEHSQRSKKAVWHKLLSKQRKRAVVAC
FRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKRVD
PLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEVTGSQRS
KEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQ
QKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSASHFESHRL
RTGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQE
SISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDA
VVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDML
VESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSET
EFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAE
SVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEK
EKMELFVNFCEDTIFEMQLAAQISESDLNGRSANKEESEKERPEEQGPRMAFFSVLTVKS
ALFALRYNILTLMRMLSLKSLKKQMKKVKKMTVKDMVTAFFSSYWSIFVTLLHFVASVFR
GFSRIICSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDGEEGERKPLEAALPSEDL
TDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQK
AKEEEKEEKEETKSEPEKAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKK
IIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAK
VTSLDSSSHRIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKRE
KEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGR
DRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLA
WYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTV
VAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYR
IIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPH
GFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYE
DQLN
NT seq 14955 nt   +upstreamnt  +downstreamnt
atgggggcggagggcgaagacgagatccagttcctgcgaactgatgatgaagtggttctg
cagtgcaccgcaaccatccacaaagaacaacagaagctatgcttggcagcagaaggattt
ggcaacagactttgtttcttggagtccacttccaattccaagaatgtgcccccagacctc
tccatctgcacctttgtgctggagcagtccctctctgtccgggcgctgcaggagatgctg
gctaacaccgtggagaaatcagaagggcaagttgatgtggaaaaatggaaattcatgatg
aagactgctcaaggtggtggtcatcgaacactcctctacggacatgccatattgctgcgc
cattcctatagtggcatgtatctgtgctgcctgtccacctcccggtcttcaactgataag
ctggcttttgatgttggcttgcaagaggacaccacaggggaggcttgttggtggaccata
caccctgcctctaagcagcgatcagaaggagaaaaagtacgagttggagatgacctcatc
ttagttagcgtgtcctctgaaaggtacttgcacttgtcttatggcaatggcagcttacac
gtggatgccgctttccagcagactctctggagcgtggccccaatcagctcaggaagtgag
gcagcccaagggtatctcattggtggtgatgtcctcaggttgctgcatggacacatggac
gagtgtctcactgtcccttcaggagaacatggtgaagagcagcggagaactgttcattat
gaaggtggcgctgtgtctgttcatgcacgttccctttggagactagagacgctaagagtt
gcgtggagtggaagccacataaggtggggacagccgttccgactacgccacgtcacaaca
ggaaaatacttgagtctcatggaagacaaaaaccttctactcatggacaaagagaaagct
gatgtaaaatcaacagcccttaccttccggtcttccaaggaaaaattggatgtaggggtg
agaaaagaagtcgacggcatgggaacatctgaaataaaatacggtgactcagtatgctat
atacaacatgtagacacaggcctatggcttacttaccagtctgtggacgtgaaatccgtg
agaatgggatctatacaacgtaaggctattatgcatcatgaaggccacatggatgatggc
ataagtttatcgagatcccagcatgaagaatcacgcacagcacgagttatccggagcaca
gtcttccttttcaatagatttataaggggccttgatgctctcagcaagaaagcgaaggct
tccacagtcgatttgcctatagagtccgtaagtctaagtctgcaggatctcattggctac
ttccaccccccagatgagcatttagagcatgaagacaaacagaacagactacgagccctg
aagaatcggcaaaatctcttccaggaagagggaatgatcaacctcgtgcttgagtgcata
gaccgtttgcacgtctacagcagtgcagcacactttgctgatgttgctgggcgagaagca
ggagagtcttggaaatccattctgaattctctgtatgagttgctggcggctctaattaga
ggaaatcgtaaaaactgtgctcaattttccggctccctcgactggttgatcagcagattg
gaaagactggaagcttcttcgggcattctggaagttttacactgtgttttagtagaaagt
ccagaagctctaaatattattaaagaaggacatattaaatctattatctcacttttagac
aaacatggaagaaatcacaaggttctggatgttttgtgctcactctgtgtttgccacggg
gttgcggtccgttctaaccagcatctcatctgtgacaatctcttaccaggaagagacttg
ttattgcagacacgtcttgtgaaccatgtcagcagcatgagacccaatatttttctgggc
gtcagtgaaggttctgctcagtataagaaatggtactatgaattgatggtggaccacaca
gagccctttgtgacagctgaagcgactcacctgcgagtgggctgggcttccactgaaggg
tattctccctaccctggagggggcgaagagtggggtggaaatggtgttggagatgatctc
ttctcctatggatttgatggccttcatctctggtcaggttgtattgctcgtactgtaagc
tcaccaaaccaacatctgttaagaactgatgatgtcatcagttgctgtttagatctgagt
gccccaagcatctcgttccgaattaatggacaacctgttcaaggaatgtttgagaatttc
aacatcgatggcctcttctttccagtcgttagtttctctgcaggaataaaagtacgcttt
ctgcttggagggcgacatggagaattcaaatttcttcctccacctgggtatgctccttgt
tatgaagctgttctgccaaaagaaaagttgaaagtggaacacagccgagagtacaagcaa
gaaagaacgtacacacgcgacctgctgggccccacagtttccctgacgcaagctgccttc
acacccatccctgtggataccagccagatcgtgttgcctcctcatctagaaagaataaga
gaaaaactggcagagaatatccatgaactctgggttatgaataaaattgagcttggctgg
cagtatggtccggttagagatgacaacaagagacaacacccatgcctggtggagttctgc
aagctgcctgaacaggagcgcaattacaacttacaaatgtcgcttgagaccctgaagact
ttgttggcattaggatgtcatgtgggtatatcagatgaacatgctgaagacaaggtgaaa
aaaatgaagctacccaagaattaccagctgacaagtggatacaagcctgcacctatggac
ctgagctttatcaaactcaccccatcgcaagaagcaatggtggacaagttggcagaaaat
gcgcataatgtgtgggcgcgggatcgaatccggcagggctggacttatggcatccaacag
gacgtaaagaacagaagaaatcctcgccttgttccctacactcttctggatgaccgaacc
aagaaatccaacaaggacagcctccgcgaggctgtgcgcacgctgctggggtacggctac
aacttggaagcaccagatcaagatcatgcagccagagccgaagtgtgcagcggcactggg
gaaaggttccgaatcttccgtgccgagaagacctatgcagtgaaggccggacggtggtat
tttgaatttgagacggtcactgctggagacatgagggttggttggagtcggcctggttgt
cagccggatcaggagcttggctcagatgaacgtgcctttgcctttgatggcttcaaggcc
cagcggtggcatcagggcaatgaacactatgggcgctcttggcaagcaggcgatgttgtg
gggtgtatggttgacatgaacgaacacaccatgatgttcacactgaatggtgaaatcctt
cttgatgattcaggctcagaactggctttcaaggactttgatgtgggcgatggattcata
cctgtgtgtagccttggagtggctcaagtgggtaggatgaactttggaaaggatgtcagc
accttgaaatatttcaccatctgtggcttacaagagggctatgaaccatttgccgttaat
acaaacagggatattaccatgtggctgagcaagaggcttcctcagtttcttcaagttcca
tcaaaccatgaacatatagaggtgaccagaatagacggcaccatagacagttccccatgt
ttaaaggtcactcagaagtcttttggttctcagaacagcaacactgatatcatgttttat
cgcctgagcatgccgatcgagtgcgcggaggtcttctccaagacggtggctggagggctc
cctggggctggccttttcgggcccaagaatgacttggaagattatgatgctgattctgac
tttgaggttctgatgaagacagctcatggccatctagtgcccgatcgtgttgacaaagac
aaagaagctactaaaccagagtttaacaaccacaaagattatgcccaggaaaagccctct
cgtctgaaacaaagatttttgcttagaagaacaaagccagattacagcacaagccattct
gcaagactcaccgaagatgtccttgctgatgatcgggatgactatgatttcttgatgcaa
acgtccacgtactattactcagtgagaatctttcctggacaagaacctgctaatgtctgg
gtgggctggattacatcagatttccatcagtatgacacaggctttgacttggacagagtt
cgcacagtaacagttactctaggagatgaaaaaggaaaagtgcatgaaagcatcaaacgc
agcaactgctatatggtatgtgcgggtgagagcatgagccccgggcaaggacgcaacaat
aatggactggagattggctgtgtggtggatgctgccagcgggctgctcacattcattgcc
aatggcaaggaactgagcacatactatcaggtggaaccgagtacaaaattatttcctgcg
gtttttgcacaagctacaagtcccaatgttttccagtttgagttgggaagaataaagaat
gtgatgcctctctcggcgggattattcaagagtgaacacaagaaccccgtgccgcagtgc
cccccgcgcctccacgtgcagttcctgtcacacgtcctgtggagcagaatgcccaaccag
tttttgaaggtagatgtgtctcgaataagtgaacgccaaggctggttggtgcagtgtttg
gatcctctgcagttcatgtctcttcatatccctgaggaaaacagatctgttgacatctta
gagttgacagagcaggaggaattgctgaaatttcactatcacaccctccggctctactca
gccgtctgtgctcttgggaaccaccgggtggcccatgccctgtgcagccatgtggatgaa
cctcagctcctctatgccattgagaacaagtacatgcctggtttgctgcgtgctggctac
tatgacctgctgattgacatccacctgagctcctatgccactgccaggctcatgatgaac
aacgagtacattgtccccatgacggaggagacgaagagcatcaccctgttccctgatgag
aacaaaaagcacggccttccagggatcggcctcagcacctccctcaggccacggatgcag
ttttcctcccccagttttgtaagcattagtaatgaatgttaccagtacagtccagagttc
ccactggacatcctcaagtccaaaaccatacagatgctgacagaagctgttaaagagggc
agtcttcatgcccgggacccagttggagggactactgaattcctctttgtacctctcatc
aagcttttctatacgctgctgatcatgggcatctttcacaacgaggacttgaagcacatc
ttgcagttgattgagcccagtgtgtttaaagaagctgccactccggaggaggagagtgac
acgctggagaaagagctcagtgtggacgatgcaaagctgcaaggagctggtgaggaagaa
gccaaggggggcaagcggcccaaggaaggcctgctccaaatgaaactgccagagccagtt
aaattgcagatgtgcctactgcttcagtacctctgtgactgccaggtccggcaccggata
gaagccattgtagccttttcagatgattttgtggctaagctccaagacaatcaacgtttc
cgatataacgaagtcatgcaagccttaaacatgtcagctgcactcacagccaggaaaaca
aaggaatttagatcaccacctcaagaacagatcaatatgcttctcaattttaaggatgac
aaaagtgaatgtccatgtccagaagaaattcgtgaccaactattggatttccatgaagat
ttgatgacacactgtggaattgagctggatgaagatgggtctctggatggaaacagtgat
ttaacaattagagggcgtctgctatccctggtagaaaaggtgacatatctgaagaagaag
caagcagaaaaaccagttgagagtgactccaaaaagtcctccactctgcagcagctgatc
tctgagaccatggtccgatgggctcaggagtctgtcattgaagaccccgagctggtgagg
gccatgttcgtgttgctccatcggcagtatgacggcattgggggtcttgttcgggccctg
ccaaagacctacacgataaatggtgtgtccgtggaggacaccatcaacctgctggcatcc
cttggtcagattcggtccctgctgagtgtgagaatgggcaaagaagaagagaagcttatg
attcgtggattaggggatattatgaataacaaagtgttttaccagcaccctaatctcatg
agggcactggggatgcacgagactgtgatggaggtcatggtgaacgtccttggaggtgga
gagtccaaggaaatcacctttcccaagatggtggccaactgttgccgttttctctgttac
ttctgtcgtataagtaggcagaatcaaaaagctatgtttgatcatctcagttatttactg
gaaaacagtagtgttggtcttgcctccccagctatgagaggttcaacaccactggatgtg
gctgcagcttcggtgatggataataatgaactagcattagctctgcgtgagccggatcta
gaaaaggtagttcgttatttggctggttgtggactgcaaagttgccagatgctggtgtct
aagggctatccagacattgggtggaacccagttgaaggagagagatatcttgactttctc
agatttgctgtcttctgtaatggggagagtgtggaggaaaatgcaaatgtcgtggtgaga
ttgctcattcggaggcctgagtgttttggtcctgctttgagaggagaaggtgggaatggg
cttcttgcagcaatggaagaagccatcaaaatcgccgaggatccttcccgagatggtccc
tcaccaaatagcggatccagtaaaacacttgatacagaggaggaggaagatgacactatc
cacatggggaacgcgatcatgaccttctattcagctttgattgacctcttgggacgctgt
gctcctgagatgcatttgattcatgctgggaagggagaagccatcagaattaggtccatt
ttgagatccctaattcccctgggagatttggtgggcgttatcagcatcgcttttcagatg
ccaacaatagccaaagatgggaatgtggtggaacctgacatgtctgcggggttttgccca
gatcacaaggcagccatggttttattccttgacagggtctatggaattgaggttcaagac
ttcctcctccatcttcttgaggttggctttctgccagatctccgggcagctgcttcttta
gatacggcagctttgagtgctacagacatggccttggccctcaatcggtacctttgcaca
gccgtcttgccattgttaacaagatgtgctcctctctttgctggcacagagcaccacgct
tctctcattgactcattacttcatactgtgtatagactttctaagggctgttcacttacc
aaagctcagcgggattccatagaagtttgtttactctctatttgtggacaactgagacct
tctatgatgcagcacttactcagaagattagtatttgatgttccattattaaatgaacac
gcaaagatgcctcttaaactgctgacaaatcattatgaaagatgctggaaatattactgc
ctgcctggagggtggggaaactttggtgctgcctcagaagaagaacttcatttatcaaga
aagttgttctggggcatttttgatgccctgtctcaaaagaaatatgaacaagaacttttc
aaactggcactgccttgcctgagtgcagttgcgggagctttgcctccagactacatggag
tcaaattatgtcagtatgatggaaaaacagtcatcaatggattctgaagggaactttaac
ccacaacctgttgatacctcaaatattacaattcctgagaagttggaatacttcattaac
aaatatgcagaacactcccatgacaaatggtcaatggacaagttggcaaatggatggatt
tatggagaaatatattcagactcttctaaggttcagccattaatgaagccatataagcta
ttgtctgaaaaggaaaaagaaatttaccgctggccaatcaaagaatctttaaaaactatg
ctggcttggggctggagaattgaaagaactcgggagggagacagcatggccctttacaac
cggactcgtcgtatttctcagacaagccaggtttctgtagacgctgcccatggttacagt
ccccgggccattgacatgagcaatgttacgctatctagagacctgcatgctatggcagaa
atgatggctgaaaactaccataatatatgggcaaagaaaaagaaaatggagttggagtcc
aaaggaggaggaaaccatcctctgctggtgccctatgatacactgacagccaaagagaaa
gccaaggatagagaaaaagcacaggacatcctcaagttcttgcagatcaatggatatgct
gtatccagaggatttaaggacctggaactggacacgccttctattgagaaacgatttgcc
tatagtttcctccaacaactcattcgctatgtggatgaagcccatcagtatatcctggag
tttgatggtggcagcagaggcaaaggagaacatttcccttatgaacaagaaatcaagttc
tttgcaaaagtcgttcttcctttaattgatcagtatttcaaaaaccatcgtttatacttc
ttatctgcagcaagcagacctctctgctctggaggacatgcttccaacaaagagaaagaa
atggtgactagcctattctgcaaacttggagttcttgtcaggcataggatttcactattt
ggcaatgatgcaacatcaattgtcaactgtcttcatattttgggtcagactttggatgca
aggacagtgatgaagactggcctggagagtgttaaaagtgcactcagagcttttctggac
aacgctgcagaggatctggagaagaccatggaaaacctcaagcagggccagttcactcac
acccgaaaccagcccaaaggggttactcagattatcaattacaccacagtggccctgctg
ccaatgctgtcttcattatttgaacatattggccagcatcagttcggagaagacctaata
ttggaagatgtccaggtgtcttgttatagaattctgactagcttatatgctttgggaacc
agcaagagtatttacgtggagaggcaacgttctgcattaggagaatgtctagctgccttt
gctggtgctttccctgtagcatttttggaaactcatctggacaaacataatatttactcc
atctacaataccaagtcttcacgagaaagagcagctctcagtttgccaactaatgtggaa
gatgtttgtccaaacataccgtctttggagaaactcatggaagaaatcgtggaattagcc
gagtccggcattcgctacactcaaatgccacatgtcatggaagtcatactgcccatgctt
tgcagctacatgtctcgttggtgggagcatggacctgagaacaatccagaacgggccgag
atgtgctgcacagccctgaactcagagcacatgaacacacttctagggaacatattgaaa
atcatatataataacttggggattgatgagggagcctggatgaagaggctagcagtgttt
tcccagcctataataaataaagtgaaacctcagctcttgaaaactcatttcttgccatta
atggagaaactcaagaaaaaggcagctacggtggtgtctgaggaagaccacctgaaagcc
gaggccaggggggacatgtcggaggctgaactcctgatcctagatgagttcaccacactg
gccagagatctctatgccttctaccctctcttgattagatttgtggactataacagggca
aagtggctaaaggagcctaacccagaagcagaggagctcttccgcatggtggctgaagtg
tttatctactggtccaagtcccataatttcaaaagagaagagcagaacttcgttgtacag
aatgaaatcaacaatatgtctttccttattactgataccaagtcaaagatgtcaaaggca
gctgtttctgatcaggaaaggaagaaaatgaagcgcaaaggagatcggtattccatgcag
acctctctgattgtagcagctctgaagcggttactgcccattgggttgaacatctgtgcc
cctggggaccaggagctcattgctctggccaaaaatcgatttagcctgaaagatactgag
gatgaagtacgagatataatccgcagcaatattcatttacaaggcaagttggaggatcct
gctattagatggcaaatggctctttacaaagacttaccaaacaggactgatgatacctca
gatccagagaagacggtagaaagagtattggatatagcaaatgtgctttttcatcttgaa
cagaagtctaaacgtgtgggtcggagacattactgtctggtggaacattctcagagatct
aaaaaggctgtatggcataaactactctctaagcagaggaaaagggctgttgtagcctgc
ttccggatggcccccttatataatctgccaaggcatcgggctgtcaatctctttcttcag
ggatatgaaaagtcttggattgaaacagaagaacattactttgaagataaactgatagaa
gatttagcaaaacctggggctgaacctccagaagaagatgaaggcactaagagagttgat
cctctacatcagctgatccttctgtttagtcggacagctttaacagagaaatgcaaactg
gaggaagattttttatatatggcctatgcagatattatggcaaagagttgtcatgatgag
gaagatgacgatggtgaagaggaagtgaagagttttgaagtcacaggatcccaacgcagc
aaggaaaaagaaatggaaaaacaaaagcttctataccagcaagcccgactccacgatcgt
ggcgcggctgagatggtgctacagacaatcagtgccagcaaaggtgaaactggaccaatg
gtagcagctactctgaaacttggaattgctattttaaatggtgggaactccacagtacag
cagaaaatgcttgactacctcaaggagaaaaaggatgtgggcttctttcagagcctggcc
ggcctgatgcagtcatgtagtgtccttgacctaaatgcatttgagcgacaaaacaaagct
gaaggtcttgggatggtgacagaggaaggatcagcctctcactttgaaagtcacagactg
cggactggagaaaaggttctgcaggacgatgagttcacctgtgacctcttccgattcctg
caactactctgtgagggacacaactcagattttcagaattatctgagaactcagactggc
aataatacaactgtcaacataattatctccactgtagactacctactgagagttcaggaa
tcaattagtgacttttattggtattactctgggaaagatgttattgatgaacaaggacaa
cggaatttctccaaagctatccaagtggcaaaacaagtctttaacactcttacagagtat
attcagggtccttgcactgggaatcaacagagtttggcacacagcaggctgtgggatgct
gtggtcggctttcttcatgtgtttgcccatatgcagatgaagctgtcgcaggattccagt
caaattgagctattaaaagaattaatggatctgcagaaggatatggtggtcatgttgctg
tccatgttagaaggtaatgttgttaatggaacgattggcaaacagatggtggatatgctt
gtggaatcttccaacaatgtggagatgattctcaaattttttgacatgttcttaaaacta
aaggatttgacgtcgtctgatacttttaaagaatatgaccccgatggcaagggagtcatt
tccaagagggacttccacaaagcgatggagagccataagcactacacgcagtcagaaacg
gaatttcttctgtcttgtgcggagacggatgagaatgaaaccctcgactacgaagagttc
gtcaaacgcttccacgaacctgcgaaggacatcggcttcaatgtcgccgtccttctgaca
aacctctccgagcacatgcccaacgatacccgacttcagacttttctggaattagcagag
agcgtcctgaattatttccagccctttctgggccgcatcgaaatcatgggaagcgccaaa
cgcatcgagagagtctattttgaaatcagcgagtccagccgaacccagtgggagaagccc
caggtcaaggagtccaaaagacagttcatatttgacgtggtcaacgaaggaggagagaaa
gagaagatggaactcttcgtgaacttctgcgaggacaccatctttgaaatgcagctggcg
gctcagatctcggagtcggacttgaacgggaggtcagcgaacaaggaagagagcgagaag
gagaggccggaagagcagggcccgaggatggcgttcttctccgtcctgacggtcaagtcg
gccctgtttgcgctcaggtacaatatcttgacccttatgcgaatgctcagtctgaagagc
ctgaagaagcagatgaaaaaagtaaaaaagatgaccgtgaaggacatggtcacggccttc
ttttcgtcctactggagtattttcgtgaccctcttgcacttcgtggccagcgttttcaga
ggcttttcccgcatcatttgcagcctgctgcttgggggaagcctcgtcgaaggtgctaaa
aagatcaaagttgcagaactgttagccaacatgccagaccccactcaggatgaggttaga
ggagatggggaggagggagagaggaaacccctggaagccgccctgccctccgaggatctg
accgacttaaaggagctgacagaggaaagtgaccttctttcggacatctttggcctggat
ctgaagagagaaggaggacagtacaaactgattcctcataatccaaatgctgggctcagt
gacctcatgagcaacccagtccccatgcctgaggtgcaggaaaaatttcaggaacagaag
gcaaaagaagaagaaaaggaagaaaaagaagaaaccaaatctgaacctgaaaaagccgag
ggagaagatggagaaaaagaagagaaagccaaggaagacaagggcaaacaaaagttgagg
cagcttcacacacacagatacggagaaccagaagtgccagagtcagcattctggaagaaa
atcatagcatatcaacagaaacttctaaactattttgctcgcaacttttacaacatgaga
atgttagccttatttgtcgcatttgctatcaatttcatcttgctcttctataaggtctcc
acttcttctgtggttgaaggaaaggagctccccacgagaagttcaagtgaaaatgccaaa
gtgaccagcctggacagcagctcccatagaatcatcgcagttcactatgtactagaggag
agcagcggctacatggagcccacgttgcgtatcttagctattctgcacacggtcatttct
ttcttctgcatcattggatactactgcttgaaagtcccattggttatttttaagcgagaa
aaggaagtggcacggaaattggaatttgatgggctttatattacagaacagccttcagaa
gatgatattaaaggccagtgggacagactcgtaatcaacacacagtcatttcccaacaac
tactgggacaaatttgttaaaagaaaggttatggataagtatggagagttctacggccga
gacagaatcagtgaattacttggcatggacaaggcagctctggacttcagtgatgccaga
gaaaagaagaagccaaagaaagacagctccttatcagctgtactgaactccattgatgtg
aagtatcagatgtggaaactaggagtcgttttcactgacaattccttcctctacctagcc
tggtatatgactatgtctgttcttggacactataacaactttttttttgccgctcacctt
ctcgacattgctatgggattcaagacattaagaaccatcttgtcctcagtaactcacaat
ggcaaacagctcgtattaaccgttggcttattagctgttgttgtatacctatacactgtg
gtggcattcaattttttccgaaaattctacaataaaagtgaagatggtgatacaccagat
atgaaatgtgatgatatgctaacatgctatatgttccacatgtatgttggagttcgtgct
ggaggagggatcggggatgaaatcgaagacccagcaggagatgaatatgagatctatcga
atcatctttgacatcactttcttcttctttgttattgtcattctcttggccataatacaa
ggtctaattatcgatgcttttggagaactaagagaccaacaggaacaagtcaaagaagac
atggagaccaaatgcttcatctgtgggataggcaatgattacttcgacacagtgccacat
ggctttgaaacccacactttacaggagcacaacttggctaattacttgttttttctgatg
tatcttataaacaaagatgaaacagaacacacaggacaggaatcttatgtctggaagatg
tatcaagaaaggtgttgggaatttttcccagcaggggattgcttccggaaacagtatgaa
gaccagctaaattaa

KEGG   Pan paniscus (bonobo): 100992272
Entry
100992272         CDS       T02283                                 

Gene name
RYR1
Definition
(RefSeq) ryanodine receptor 1
  KO
K04961  ryanodine receptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04371  Apelin signaling pathway
pps04713  Circadian entrainment
pps04730  Long-term depression
pps04921  Oxytocin signaling pathway
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100992272 (RYR1)
   04020 Calcium signaling pathway
    100992272 (RYR1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100992272 (RYR1)
  09156 Nervous system
   04730 Long-term depression
    100992272 (RYR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100992272 (RYR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100992272 (RYR1)
   05020 Prion disease
    100992272 (RYR1)
   05022 Pathways of neurodegeneration - multiple diseases
    100992272 (RYR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100992272 (RYR1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100992272 (RYR1)
   04040 Ion channels [BR:pps04040]
    100992272 (RYR1)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100992272 (RYR1)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100992272 (RYR1)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Ryanodine receptor
   100992272 (RYR1)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 CDC45
Other DBs
NCBI-GeneID: 100992272
NCBI-ProteinID: XP_003812341
Position
19
AA seq 4922 aa
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPD
LAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCL
TTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQ
RRLVYYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRVRHVTTGRYLALTEDQGLVV
VDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSF
SGKPRGSGPPAGTALPIEGVILSLQDLIIYFEPPSEDLQHEEKQSKLRSLRNRQSLFQEE
GMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLD
VLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYSK
WYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVV
SFSAGVRVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVG
PSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMM
SNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQDIPARRNPRL
VPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGR
PWQPGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGH
LNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAED
EARAAEPDPDYENLRRSAGGWGEAENGKEGTAKEGAPGGTPQAGGEVQPARAENEKDATT
EKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFV
SPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNV
IQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRV
AHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPE
TRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVK
QILKMIEPEVFTEEEEEEDEEEEEDEEEDEEEKEEDEEETAQEKEDEEKEEEEAAEGEKE
EGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGL
LIKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLL
AHCGIQLDGEEEEPEEETTLGSRLMSLLEKVRLVKKKEEKPEEERSAEESKPRSLQELVS
HMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECL
GQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGE
SKEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAAS
VIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAV
FVNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRR
DRRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRS
LVPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLL
HVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMV
DSMLHTVYRLSRGRSLTKAQRDVIEDCLMSLCRYIRPSMLQHLLRRLVFDVPILNEFAKM
PLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMA
MPCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFA
EYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAW
EWTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLA
ENYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTR
GLKDMELDSSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFA
KILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGT
DAPAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQAR
TQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTK
NTYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEM
CPDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAG
APPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLQSHFI
PTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNN
RAQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMA
KSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLITLAKTRYALKD
TDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLY
YLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILT
EDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMA
YADIMAKSCHLEEGGENGEAEEEVEVSFEEKEMEKQRLLYQQARLHTRGXAEMVLQMISA
CKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLN
AFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRT
QTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSL
TEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVV
MLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPR
GLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAV
LLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQW
EMPQVKESKRQFIFDVVNEGGEAEKMELFVSFCEDTIFEMQIAAQISEPEGEPETDEDEG
AGAAEAGAEGAEEGDEVHGEQPAGPGGDADGEGASEGAGDAAEGAGDEEEAVHEAGPGGA
DGAVAMTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPE
PELEPEKADAENGEKEEVPEPPPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLNYL
SRNFYTLRFLALFLAFAINFILLFYKVSDSPPGEDDMEGSAAGDVSGAGSGGGSGWGLGA
GEEAEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREK
ELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIYGRE
RIAELLGMDLATLEITAHNERKPNPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLGWY
MVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVA
FNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVV
FDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGF
ETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQ
LS
NT seq 14769 nt   +upstreamnt  +downstreamnt
atgggtgacgcagaaggcgaagacgaggtccagttcctgcggacggacgatgaggtggtc
ctgcagtgcagcgctaccgtgctcaaggagcagctcaagctctgcctggccgccgagggc
ttcggcaaccgcctgtgcttcctggagcccactagcaacgcgcagaatgtgccccccgat
ctggccatctgttgcttcgtcctggagcagtccctgtccgtgcgagccctgcaggagatg
ctggctaacacggtggaggctggcgtggagtcatcccagggcgggggacacaggacgctc
ctgtatggccatgccatcctgctccggcatgcacacagccgcatgtatctgagctgcctc
accacctcccgctccatgactgacaagctggccttcgatgtgggactgcaggaggacgca
acaggagaggcttgctggtggaccatgcacccagcctccaagcagaggtctgaaggagaa
aaggtccgcgttggggatgacatcatccttgtcagcgtctcctccgagcgctacctgcac
ctgtcgaccgccagtggggagctccaggttgatgcttccttcatgcagacactgtggaac
atgaaccccatctgctcccgctgcgaagagggcttcgttacgggaggtcacgtcctccgc
ctctttcatggacatatggatgagtgtctgaccatttcccctgctgacagtgatgaccag
cgcagacttgtctactatgaggggggagctgtgtgcacccacgcccgctccctctggagg
ctggagccactgagaatcagctggagtgggagccacctgcgctggggccagccactccga
gtccggcatgtcaccaccgggcggtacctagcgctcaccgaggaccagggcctggtggtg
gttgacgccagcaaggctcacaccaaggctacctccttctgcttccgcatctccaaggag
aagctggatgtggcccccaagcgggatgtggagggcatgggcccccctgagataaagtac
ggggagtcactgtgcttcgtgcagcatgtggcctcaggactgtggctcacctatgccgct
ccagaccccaaggccctgcggctcggcgtgctcaagaagaaggccatgctgcaccaggag
ggccacatggacgacgcactgtcgctgacccgctgccagcaggaggagtcccaggccgcc
cgcatgatccacagcaccaatggcctatacaaccagttcatcaagagcctggacagcttc
agcgggaagccacggggctcggggccaccggctggcacggcgctgcccatcgagggcgtt
atcctgagcctgcaggacctcatcatctactttgagcctccctccgaggacttgcagcac
gaggagaagcagagcaagctgcgaagcctgcgcaaccgccagagcctcttccaggaggag
gggatgctctccatggtcctgaattgcatagaccgcctaaatgtctacaccactgctgcc
cactttgctgagtttgcaggggaggaggcagccgagtcctggaaagagattgtgaatctt
ctctatgaactcctagcttctctaatccgtggcaatcgtagcaactgtgccctcttctcc
acaaacttggactggctggtcagcaagctggatcggctggaggcctcgtctggcatcctg
gaggtcctgtactgtgtcctcattgagagtccggaggttctgaacatcatccaggagaat
cacatcaagtccatcatctccctcctggacaagcatgggaggaaccacaaggtcctggac
gtgctatgctccctgtgtgtgtgtaatggtgtggctgtacgctccaaccaagatcttatt
actgagaacttgctgcctggccgtgagcttctgctgcagacaaacctcatcaactatgtc
accagcatccgccccaacatctttgtgggccgagcggaaggcaccacgcagtacagcaaa
tggtactttgaggtgatggtggacgaggtgactccatttctgacagctcaggccacccac
ttgcgggtgggctgggccctcaccgagggctacaccccctaccctggggccggcgagggc
tggggcggcaacggggtcggcgatgacctctattcctacggctttgatggactgcatctc
tggacaggacacgtggcacgcccggtgacttccccagggcagcacctcttggcccctgaa
gatgtgatcagctgctgcctggacctcagtgtgccgtccatctccttccgcatcaacggc
tgccccgtgcagggtgtctttgagtccttcaacctggacgggctcttcttccctgttgtc
agcttctcggctggtgtcagggtgcggttcctccttggtggccgccatggtgaattcaag
ttcctgcccccacctggctatgctccatgccatgaggctgtgctccctcgagagcgactc
catcttgaacccatcaaggagtatcgacgggaggggccccgggggcctcacctggtgggc
cccagtcgctgcctctcacacaccgacttcgtgccctgccctgtggacactgtccagatt
gtcctgccgccccatctggagcgcattcgggagaagctggcggagaacatccacgagctc
tgggcgctaacccgcatcgagcagggctggacctacggcccggttcgggatgacaacaag
aggctgcacccgtgtcttgtggacttccacagccttccagagcctgagaggaactacaac
ctgcagatgtctggggagacgctcaagactctgctggctctgggctgccacgtgggcatg
gcggatgagaaggcggaggacaacctgaagaagacaaaactccccaagacgtatatgatg
agcaatgggtacaagccggctccgctggacctgagccatgtgcggctgacaccggcgcag
acgacactggtggaccgtctggcagaaaatgggcacaacgtgtgggcccgagaccgcgtg
ggccagggctggagctacagcgcagtgcaggacatcccagcgcgccgaaaccctcggctg
gtgccctaccgcctgctggacgaagccaccaagcgcagcaaccgggacagcctctgccag
gccgtgcgcaccctcctgggctacggctacaacatcgagcctcctgaccaggagcccagt
caggtggagaaccagtctcgctgtgaccgggtgcgcatcttccgggcagagaaatcctat
acagtgcagagcggccgctggtacttcgagtttgaagcagtcaccacaggcgagatgcga
gtgggctgggcgaggcccgagctgaggcctgatgtagagctgggagctgacgagctggcc
tatgtcttcaatgggcaccgcggccagcgctggcacttgggcagtgaaccatttgggcgc
ccctggcagccgggcgatgtcgttggctgtatgatcgacctcacagagaacaccattatc
ttcaccctcaatggcgaggtcctcatgtctgactcaggctccgaaacagccttccgggag
attgagattggggacggcttcctgcccgtctgcagcttgggacctggccaggtgggtcat
ctgaacctgggccaggacgtgagctctctgaggttctttgccatctgtggcctccaggaa
ggcttcgagccatttgccatcaacatgcagcgcccagtcactacctggttcagcaaaggc
ctgccccagtttgagccagtgccccttgaacaccctcactatgaggtatcccgagtggac
ggcactgtggacacgcccccctgcctgcgcctgacccaccgcacctggggctcccagaac
agcctggtggagatgctcttcctgcggctgagcctcccagtccagttccaccagcacttc
cgctgcactgcaggggccaccccgctggcacctcctggcctgcagccccccgccgaggac
gaggcccgggcggcggaacccgaccctgactacgaaaacctgcgccgctcagctgggggc
tggggcgaggcagagaacggcaaagaagggactgcgaaggagggcgcccccgggggcacc
ccgcaggcggggggagaggtgcagccggccagggcggagaatgagaaggacgccaccacc
gagaagaacaagaagagaggcttcttattcaaggccaagaaggtcgccatgatgacccag
ccaccggccacccccacgctgccccgactccctcacgacgtggtgcctgcagacaaccgc
gatgaccccgagatcatcctcaacaccaccacgtactattactccgtgagggtctttgcc
ggacaggagcccagctgcgtgtgggcgggctgggtcacccctgactaccatcagcacgac
atgagcttcgacctcagcaaggtccgggtcgtgacggtgaccatgggggatgaacaaggc
aacgtccacagcagcctcaagtgtagcaactgctacatggtgtggggcggagactttgtg
agtcccgggcagcagggccggatcagccacacggaccttgtcattgggtgcctggtggac
ttggccactggcttaatgacctttacagccaatggcaaagagagcaacacctttttccag
gtggaacccaacacaaagctatttcctgccgtcttcgtcctgcccacccaccagaacgtc
atccagtttgagctggggaagcagaagaacatcatgccgttgtcagccgccatgttccaa
agcgagcgcaagaacccggccccgcagtgcccaccgcggctggagatgcagatgctgatg
ccagtgtcctggagccgcatgcccaaccacttcctgcaggtggagacgaggcgtgccggc
gagcggctgggctgggccgtgcagtgccaggagccgctgaccatgatggcgctgcacatc
cccgaggagaaccggtgcatggacatcctggagctgtcggagcgcctggacctgcagcgc
ttccactcgcacaccctgcgcctctaccgcgctgtgtgcgccctgggcaacaatcgcgtg
gcgcacgctctgtgcagccacgtagaccaagctcagctgctgcacgccctggaggacgcg
cacctgccaggcccactgcgcgcaggctactatgacctcctcatcagcatccacctcgaa
agtgcctgccgcagccgccgctccatgctctctgaatacatcgtgcccctcacgcctgag
acccgcgccatcacgctcttccctcctggaaggagcacagaaaatggtcacccccggcat
ggcctgccgggagttggagtcaccacttcgctgaggcccccgcatcatttctcgcccccc
tgtttcgtggccgctctgccagctgctggggcagcagaggccccggcccgcctcagccct
gccatcccgctggaggccctgcgggacaaggcactgaggatgctgggggaggcggtgcgc
gacggtgggcagcacgctcgcgaccccgtcgggggctccgtggagttccagtttgtgcct
gtgctcaagctcgtgtccaccctgctggtgatgggcatctttggcgatgaggatgtgaaa
cagatcttgaagatgattgagcctgaagtcttcactgaggaagaagaggaggaggacgag
gaggaggaagaggatgaagaggaagatgaggaggagaaggaggaggatgaggaggaaaca
gcacaggaaaaggaagatgaggaaaaagaggaagaggaggcagcagaaggggagaaagaa
gaaggcttggaggaagggctgctccagatgaagttgccagagtctgtgaagttacagatg
tgccacctgctggagtatttctgtgaccaagagttgcagcaccgtgtggagtccctggca
gcctttgcggagcgctatgtggacaagctccaggccaaccagcggagccgctatggcctc
ctcataaaagccttcagcatgaccgcagcagagactgcaagacgtacccgcgagttccgc
tccccaccccaggaacagatcaatatgctattgcaattcaaagatggtacagatgaggaa
gactgtcctctccctgaagagattcgacaggatttgcttgactttcatcaagacctgctg
gcacactgtggaattcagctggatggagaggaggaggaaccagaggaagagaccaccctg
ggcagccgcctcatgagcctgttggagaaagtgcggctggtgaagaagaaggaagagaaa
cctgaggaggagcggtcagcagaggagagcaaaccccggtccctgcaggagctggtgtcc
cacatggtggtgcgctgggcccaagaggacttcgtgcagagccccgagctggtgcgggcc
atgttcagcctcctgcaccggcagtacgacgggctgggtgagctgctgcgtgccctgccg
cgggcgtacaccatctcaccatcctccgtggaagacaccatgagcctgctcgagtgcctc
ggccagatccgctcgctgctcatcgtgcagatgggcccccaggaggagaacctcatgatc
cagagcatcgggaacatcatgaacaacaaagtcttctaccaacacccgaacctgatgagg
gcgctgggcatgcacgagacggtcatggaggtcatggtcaacgtcctcgggggcggcgag
tccaaggagatccgcttccccaagatggtgacaagctgctgccgcttcctctgctatttc
tgccgaatcagccggcagaaccagcgctccatgtttgaccacctgagctacctgctggag
aacagtggcatcggcctgggcatgcagggctccacgcccctggacgtggctgctgcctcc
gtcattgacaacaatgagctggccttggcattgcaggagcaggacctggaaaaggttgtg
tcctacctggcaggctgtggcctccagagctgccccatgcttgtggccaaagggtaccca
gacattggctggaacccctgtggtggagagcgctacctggacttcctgcgctttgctgtc
ttcgtcaacggcgagagcgtggaggagaacgccaatgtggtggtgcggctgctcatccgg
aagcctgagtgcttcggacccgccctgcggggtgagggtggctcagggctgctggctgcc
atcgaagaggccatccgcatctccgaggaccctgcgagggatggcccaggcatccgcagg
gaccggcggcgcgagcactttggtgaggaaccgcctgaagaaaaccgggtgcacctggga
cacgccatcatgtccttctatgccgccttgatcgacctgctcggacgctgtgcaccagag
atgcatctaatccaagccggcaagggtgaggccctgcggatccgcgccatcctccgctcc
cttgtgcccttggaggaccttgtgggcatcatcagcctcccactgcagattcccaccctg
ggcaaagatggggctctggtgcagccaaagatgtcagcatccttcgtgccagaccacaag
gcgtccatggtgctcttcctggaccgtgtgtatggcatcgagaaccaggacttcttgctg
cacgtgctggacgtggggttcctgcccgacatgagggcagccgcctcactggacacggcc
actttcagcaccaccgagatggcgctggcgctgaaccgctacctgtgcctggccgtgctg
ccgctcatcaccaagtgtgcgccgctctttgcgggcacagaacaccgcgccatcatggtg
gactctatgctgcataccgtgtaccgcctgtctcggggtcgttcgctcaccaaggcgcag
cgtgacgtcatcgaggactgcctcatgtcgctctgcaggtatatccgcccgtcgatgctg
cagcacctgttgcgccgcctggtgttcgacgtgcccatcctcaacgagttcgccaagatg
ccactcaagctcctcaccaaccactatgagcgctgttggaagtactactgcctacccaca
ggctgggccaacttcggggtcacctcagaggaggagctgcacctcacacggaaactcttc
tggggcatctttgactctctggcccataagaaatacgacccggagctgtaccgcatggcc
atgccttgtctgtgcgccatcgccggggctctgccccccgactatgtggatgcgtcatac
tcatctaaggcagagaaaaaggccacagtggacgctgaaggcaactttgatccccggccc
gtggagaccctcaatgtgatcatcccggagaagctggactccttcattaacaagtttgcg
gagtacacacacgagaagtgggccttcgacaagatccagaacaactggtcctatggagag
aacatagacgaggagctgaagacccaccccatgctgaggccctacaagaccttttcagag
aaggacaaagagatttaccgctggcccatcaaggagtccctgaaggccatgattgcctgg
gaatggacgatagagaaggccagggagggtgaggaggagaagacggaaaagaaaaaaacg
cggaagatatcacaaagtgcccagacctatgatcctcgagaaggctacaaccctcagccc
cccgaccttagcgctgttaccctgtcccgggagctgcaggccatggcagaacaactggca
gaaaattaccacaacacgtggggacggaagaagaagcaggagctggaagccaaaggcggt
gggacccaccccctgctggtcccctacgacacgctcacggccaaggagaaggcacgagat
cgagagaaggcccaggagctactgaaattcctgcagatgaatggctacgcggttacaaga
ggccttaaggacatggaactggactcgtcttccattgaaaagcggtttgcctttggcttc
ctgcagcagctgctgcgctggatggacatttctcaggagttcattgcccacctggaggct
gtggtcagcagtgggcgagtggaaaagtccccacatgaacaggagattaaattctttgcc
aagatcctgctccctttgatcaaccagtacttcaccaaccactgcctctatttcttgtcc
actccggctaaagtgctgggcagcggtggccacgcctctaacaaggagaaggaaatgatc
accagcctcttctgcaaacttgctgctctcgtccgccaccgagtctctctctttgggacg
gacgccccggctgtggtcaactgtcttcacatcctggcccgctccctggatgccaggaca
gtgatgaagtcaggccctgagatcgtgaaggctggcctccgctccttcttcgagagtgcc
tcggaggacatcgagaagatggtggagaacctgcggctgggcaaggtgtcgcaggcgcgc
acccaggtgaaaggcgtgggccagaacctcacctacaccactgtggcactgctgccggtc
ctcaccaccctcttccagcacatcgcccagcaccagttcggagatgacgtcatcctggac
gacgtccaggtctcttgctaccgaacgctgtgcagtatctactccctgggaaccaccaag
aacacttatgtggaaaagcttcggccagccctcggggagtgcctggcccgtctggcagca
gccatgccggtggcgttcctggagccgcagctgaacgagtacaatgcctgctccgtgtac
accaccaagtctccgcgggagcgggccatcctggggctccccaacagtgtggaggagatg
tgtcccgacatcccggtgctggagcggctcatggcagacatcggggggctggccgagtca
ggtgcccgctacacagagatgccgcacgtcatcgagatcacgctgcccatgctatgcagc
tacctgccccgatggtgggagcgcgggcccgaggcaccccctcccgccctgcccgccggc
gcccccccaccctgcacagctgtcacctctgaccacctcaactccctgctggggaatatc
ctgagaatcatcgtcaacaacctgggcattgacgaggcctcctggatgaagcggctggct
gtgttcgcacagcccattgtgagccgtgcacggccggagctcctgcagtcccacttcatc
ccaactatcgggcggctgcgcaagagggcagggaaggtggtgtccgaggaggagcagctg
cgcctggaggccaaggcggaggcccaggagggcgagctgctggtgcgggacgagttctcc
gtgctctgccgggacctctacgccctgtatccgctgctcatccgctacgtggacaacaac
agggcgcagtggctgacggagccgaatcccagcgcggaggagctgttcaggatggtgggc
gagatcttcatctactggtccaagtcccacaacttcaagcgcgaggagcagaactttgtg
gtccagaatgagatcaacaacatgtccttcctgactgctgacaacaaaagcaaaatggct
aagtccggtggctcggaccaggaacgcaccaagaagaagcgccggggggaccggtactct
gtgcagacgtcactgatcgtggccacactgaagaagatgctgcccatcggcctgaatatg
tgtgcgcccaccgaccaagacctcatcacgctggccaagacccgctacgccctgaaagac
acagatgaggaggtccgggaatttctgcacaacaaccttcaccttcagggaaaggtcgaa
ggctccccgtctctgcgctggcagatggctctgtaccggggcgtcccgggtcgcgaggag
gacgccgatgaccccgagaaaatcgtgcgcagagtccaggaagtgtcagccgtgctctac
tacctggaccagaccgagcacccttacaagtctaagaaggccgtgtggcacaagcttttg
tccaaacagcgccggcgggcagtcgtggcctgtttccgtatgacgcccctgtacaacctg
cccacgcaccgggcatgtaacatgttcctggagagctacaaggctgcatggatcctgact
gaagaccacagttttgaggaccgcatgatagatgacctttcaaaagctggggagcaggag
gaggaggaggaagaggtggaagagaagaagccagaccccctgcaccagttggtcctgcac
ttcagccgcactgccctgacggaaaagagcaaactggacgaggattacctgtacatggcc
tatgctgatatcatggcaaagagctgccacctggaggagggaggggagaacggtgaagct
gaagaggaggttgaggtctcctttgaggagaaagagatggagaagcagaggctcttgtac
cagcaagcacggctgcacacccgggggncggccgagatggtgctgcagatgatcagtgcc
tgcaaaggagagacaggtgccatggtgtcctccaccctgaagctgggcatctccatcctc
aatggaggcaatgctgaggtccagcagaaaatgctggattatcttaaggacaagaaggaa
gttggcttcttccagagtatccaggcactgatgcaaacatgcagcgtcctggatctcaat
gcctttgagagacagaacaaggccgaggggctgggcatggtgaatgaggatggcactgtc
atcaatcgccagaacggagagaaggtcatggcggatgatgaattcacacaagacctgttc
cgattcctacaattgctctgtgaggggcacaataatgatttccagaactacctacggaca
cagacagggaacacgaccactattaacatcatcatttgcactgtggactacctcctgcgg
ctgcaggaatccatcagcgacttctactggtactactcgggcaaggatgtcattgaagag
cagggcaagaggaacttctccaaagccatgtcggtggctaagcaggtgttcaacagcctc
actgagtacatccagggtccctgcaccgggaaccagcagagcctggcgcacagtcgccta
tgggacgcagtggtgggattcctgcacgtgttcgcccacatgatgatgaagctcgctcag
gactcaagccagatcgagctgctgaaggagctgctggatctgcagaaggacatggtggtg
atgttgctgtcgctactagaagggaacgtggtgaacggcatgatcgcccggcagatggtg
gacatgctcgtggaatcctcatccaatgtggagatgatcctcaagttcttcgacatgttc
ctgaaactcaaggacattgtgggctctgaagccttccaggactacgtaacggatccccgt
ggcctcatctccaagaaggacttccagaaggccatggacagccagaagcagttcagcggt
ccagaaatccagttcctgctttcgtgctccgaagcggatgagaacgaaatgatcaactgc
gaagagttcgccaaccgcttccaggagccagcacgcgacatcggcttcaacgtggcggtg
ctgctgaccaacctgtcagagcatgtgccgcatgaccctcgcctgcacaacttcctggag
ctggccgagagcatccttgagtacttccgcccctacctgggccgcatcgagatcatgggc
gcctcacgccgcatcgagcgcatctacttcgagatctcagagaccaaccgcgcccagtgg
gagatgccccaggtgaaggagtccaagcgccagttcatcttcgacgtggtgaacgagggc
ggcgaggctgagaagatggagctcttcgtgagtttctgcgaggacaccatcttcgagatg
cagatcgccgcgcagatctcggagcccgagggcgagccggagaccgacgaggacgagggc
gcgggcgcggcggaggcaggcgcggaaggcgcggaggagggcgacgaggtgcacggcgag
cagccggccgggccgggcggagacgcagacggcgagggtgccagcgagggcgctggagac
gccgcagagggcgctggagacgaggaggaggcggtgcacgaggccgggccgggcggcgcc
gacggggcggtggccatgaccgatgggggccccttccggcccgaaggggctggcggtctc
ggggacatgggggacacgacgcctgcggaaccgcccacacccgagggctctcccatcctc
aagaggaaattgggggtggatggagtggaggaggagctcccgccagagccagagcccgaa
ccagagctggagccggagaaagccgatgccgagaatggggagaaggaagaagttcccgag
cccccaccagagccccccaagaagcaagcacctccctcaccccctccaaagaaggaggaa
gctggaggcgaattctggggagaactggaggtacagagggtgaagttcctgaactacctg
tcccggaacttttacaccctgcggttccttgccctcttcttggcatttgccatcaacttc
atcttgctgttttataaggtctcagactctccaccaggggaggacgacatggaaggctca
gctgctggggatgtgtcaggtgcaggctccggtggcggctctggctggggcttgggggcc
ggagaggaggcagagggcgatgaggatgagaacatggtgtactacttcctggaggaaagc
acaggctacatggaacctgccctgcggtgtctgagcctcctgcatacactggtggccttt
ctctgcatcattggctataattgtctcaaggtgcccctggtaatctttaagcgggagaag
gagctggcccggaagctggagtttgacggcctgtacatcacggagcagcctgaggacgat
gacgtgaaggggcagtgggaccgactggtgctcaacacgccgtctttccctagcaactac
tgggacaagtttgtcaagcgcaaggtcctggacaaacatggggacatctacgggcgggag
cggattgctgagctactgggcatggacctggccacattagagatcaccgcccacaatgag
cgcaagcccaacccgccgccagggctgctgacctggctcatgtccatcgatgtcaagtac
cagatctggaagttcggggtcatcttcacagacaactccttcctgtacctgggctggtat
atggtgatgtccctcttgggacactacaacaacttcttctttgctgcccatctcctggac
atcgccatgggggtcaagacgctgcgcaccatcctgtcctctgtcacccacaatgggaaa
cagctggtgatgaccgtgggccttctggcggtggtcgtctacctgtacaccgtggtggcc
ttcaacttcttccgcaagttctacaacaagagcgaggatgaggatgaacctgacatgaag
tgtgatgacatgatgacgtgttacctgtttcacatgtacgtgggtgtccgggctggcgga
ggcattggggacgagatcgaggaccccgcgggtgacgaatacgagctctacagggtggtc
ttcgacatcaccttcttcttcttcgtcatcgtcatcctgttggccatcatccagggtctg
atcatcgacgcttttggtgagctccgagaccaacaagagcaagtgaaggaggatatggag
accaagtgcttcatctgtggaatcggcagtgactactttgatacgacaccgcatggcttt
gagactcacacgctggaggagcacaacctggccaattacatgtttttcctgatgtatttg
ataaacaaggatgagacagaacacacgggtcaggagtcttatgtctggaagatgtaccaa
gagagatgttgggatttcttcccagctggtgattgtttccgtaagcagtatgaggaccag
cttagctga

DBGET integrated database retrieval system