KEGG   Pan paniscus (bonobo): 100969645
Entry
100969645         CDS       T02283                                 

Gene name
SLC8A1
Definition
(RefSeq) sodium/calcium exchanger 1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04260  Cardiac muscle contraction
pps04261  Adrenergic signaling in cardiomyocytes
pps04371  Apelin signaling pathway
pps04740  Olfactory transduction
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04974  Protein digestion and absorption
pps04978  Mineral absorption
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100969645 (SLC8A1)
   04020 Calcium signaling pathway
    100969645 (SLC8A1)
   04022 cGMP-PKG signaling pathway
    100969645 (SLC8A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100969645 (SLC8A1)
   04261 Adrenergic signaling in cardiomyocytes
    100969645 (SLC8A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    100969645 (SLC8A1)
   04978 Mineral absorption
    100969645 (SLC8A1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100969645 (SLC8A1)
  09157 Sensory system
   04740 Olfactory transduction
    100969645 (SLC8A1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100969645 (SLC8A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100969645 (SLC8A1)
   05414 Dilated cardiomyopathy
    100969645 (SLC8A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100969645 (SLC8A1)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100969645 (SLC8A1)
Transporters [BR:pps02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   100969645 (SLC8A1)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Others
   100969645 (SLC8A1)
SSDB
Motif
Pfam: Na_Ca_ex
Other DBs
NCBI-GeneID: 100969645
NCBI-ProteinID: XP_003817674
Position
2A
AA seq 335 aa
MSEKKALLLNELGGFTITGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRI
AEMGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGE
DDDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFI
GDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNV
FLGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELG
GPRTAKLLTSCLFVLLWLLYIFFSSLEAYCHIKGF
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgagtgagaagaaagccctgttattgaatgagcttggtggcttcacaataacaggccaa
cctgtcttcaggaaggttcatgctagagaacatccgattctctctactgtaatcaccatt
gcagatgaatatgacgacaagcagccactgaccagcaaagaggaagaggagaggcgcatt
gcagaaatggggcgccccatcctgggagagcacaccaagttggaagtgatcattgaagaa
tcctatgaattcaagagtactgtggacaaactcattaagaagacaaacctggcccttgtg
gttgggactaacagctggagagaacagttcattgaagctatcactgtcagtgctggggaa
gatgatgacgacgatgaatgtggggaagagaagctgccctcctgtttcgattacgtgatg
cactttctgactgtgttctggaaggtcttgtttgccttcgtcccccctactgaatactgg
aatggctgggcgtgtttcattgtctccatcctcatgattggcctactgacagctttcatt
ggagacctggcttcccactttggctgcaccattggcctgaaagattctgtgactgcagtc
gtgttcgtcgcacttggaacatcagtgccagacacatttgccagcaaagtggcagccacc
caggaccagtatgcagacgcctccataggtaacgtcacgggcagcaacgcggtgaacgtc
ttcctgggaatcggtgtggcctggtccatcgctgccatctaccacgcagccaacggggaa
cagttcaaagtgtcccctggcacactagctttctctgtcactctcttcaccatttttgct
ttcatcaatgtgggggtgctgctgtatcggcggaggccagaaatcggaggtgagctgggt
gggccccggactgccaagctcctcacatcctgcctctttgtgctcctatggctcttgtac
attttcttctcctccctggaggcctactgccacataaaaggcttctaa

KEGG   Pan paniscus (bonobo): 100972309
Entry
100972309         CDS       T02283                                 

Gene name
SLC8A1
Definition
(RefSeq) sodium/calcium exchanger 1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04260  Cardiac muscle contraction
pps04261  Adrenergic signaling in cardiomyocytes
pps04371  Apelin signaling pathway
pps04740  Olfactory transduction
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04974  Protein digestion and absorption
pps04978  Mineral absorption
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100972309 (SLC8A1)
   04020 Calcium signaling pathway
    100972309 (SLC8A1)
   04022 cGMP-PKG signaling pathway
    100972309 (SLC8A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100972309 (SLC8A1)
   04261 Adrenergic signaling in cardiomyocytes
    100972309 (SLC8A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    100972309 (SLC8A1)
   04978 Mineral absorption
    100972309 (SLC8A1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100972309 (SLC8A1)
  09157 Sensory system
   04740 Olfactory transduction
    100972309 (SLC8A1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100972309 (SLC8A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100972309 (SLC8A1)
   05414 Dilated cardiomyopathy
    100972309 (SLC8A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100972309 (SLC8A1)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100972309 (SLC8A1)
Transporters [BR:pps02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   100972309 (SLC8A1)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Others
   100972309 (SLC8A1)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex_C Na_Ca_ex DnaG_DnaB_bind
Other DBs
NCBI-GeneID: 100972309
NCBI-ProteinID: XP_003809183
Position
2A
AA seq 620 aa
MYNMRRLSLSPTFSMGFHLLVIVTLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGVI
LPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNG
ETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMF
IIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVISPGVVEVWEGLLTFF
FFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHV
ENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKS
RAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE
NCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGII
DDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIF
TFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQND
EIVVSTGLNMGIGIVFFGDS
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgtacaacatgcggcgattaagtctttcacccaccttttcaatgggatttcatctgtta
gttattgtgactctcttattttcccatgtggaccatgtaattgctgagacagaaatggaa
ggagaaggaaatgaaactggtgaatgtactggatcatattactgtaagaaaggggtgatt
ttgcccatttgggaaccccaagacccttcttttggggacaaaattgctagagctactgtg
tattttgtggccatggtctacatgtttcttggagtctctatcatagctgatcggttcatg
tcctctatagaagtcatcacatctcaagaaaaagaaataaccataaagaaacccaatgga
gagaccaccaagacaactgtgaggatctggaatgaaacagtttctaacctgaccttgatg
gccctgggatcttctgctcctgagattctcctttcagtaattgaagtgtgtggccataac
ttcactgcaggagacctcggtcctagcaccatcgtgggaagtgctgcattcaatatgttc
atcattattgcactctgtgtttatgtggtccctgacggagagacaaggaagattaagcat
ttgcgtgtgttctttgtgacagcagcctggagcatctttgcctacacctggctttacatt
attttgtctgtcatatctcctggtgttgtggaggtctgggaaggtttgcttactttcttc
ttctttcccatctgtgttgtgttcgcttgggtagcggataggagacttctgttttacaag
tatgtctacaagaggtatcgagctggcaagcagagggggatgattattgaacatgaagga
gacaggccatcttctaagactgaaattgaaatggacgggaaagtggtcaattctcatgtt
gaaaatttcttagatggtgctctggttctggaggtggatgagagggaccaagatgatgaa
gaagctaggcgagaaatggctaggattctgaaggaacttaagcagaagcatccagataaa
gaaatagagcaattaatagaattagctaactaccaagtcctaagtcagcagcaaaaaagt
agagcattttatcgcattcaagctactcgcctcatgactggagctggcaacattttaaag
aggcatgcagctgaccaagcaaggaaggctgtcagcatgcacgaggtcaacactgaagtg
actgaaaatgaccctgttagtaagatcttctttgaacaagggacatatcagtgtctggag
aactgtggtactgtggcccttaccattatccgcagaggtggtgatttgactaacactgtg
tttgttgacttcagaacagaggatggcacagcaaatgctgggtctgattatgaatttact
gaaggaactgtggtgtttaagcctggtgagactcagaaggaaatcagagtgggtatcata
gatgatgatatctttgaggaggatgaaaatttccttgtgcatctcagcaatgtcaaagta
tcttctgaagcttcagaagatggcatactggaagccaatcatgtttctacacttgcttgc
ctcggatctccctccactgccactgtaactatttttgatgatgaccacgcaggcattttt
acttttgaggaacctgtgactcatgtgagtgagagcattggcatcatggaggtgaaagta
ttgagaacatctggagctcgaggaaatgttatcgttccatataaaaccatcgaagggact
gccagaggtggaggggaggattttgaggacacttgtggagagctcgaattccagaatgat
gaaattgttgtctccacagggctaaatatgggaataggcattgtgttctttggtgacagt
tga

KEGG   Pan paniscus (bonobo): 100980273
Entry
100980273         CDS       T02283                                 

Gene name
SLC8A2
Definition
(RefSeq) solute carrier family 8 member A2
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04260  Cardiac muscle contraction
pps04261  Adrenergic signaling in cardiomyocytes
pps04371  Apelin signaling pathway
pps04740  Olfactory transduction
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04974  Protein digestion and absorption
pps04978  Mineral absorption
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100980273 (SLC8A2)
   04020 Calcium signaling pathway
    100980273 (SLC8A2)
   04022 cGMP-PKG signaling pathway
    100980273 (SLC8A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100980273 (SLC8A2)
   04261 Adrenergic signaling in cardiomyocytes
    100980273 (SLC8A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    100980273 (SLC8A2)
   04978 Mineral absorption
    100980273 (SLC8A2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100980273 (SLC8A2)
  09157 Sensory system
   04740 Olfactory transduction
    100980273 (SLC8A2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100980273 (SLC8A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100980273 (SLC8A2)
   05414 Dilated cardiomyopathy
    100980273 (SLC8A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100980273 (SLC8A2)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100980273 (SLC8A2)
Transporters [BR:pps02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   100980273 (SLC8A2)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Others
   100980273 (SLC8A2)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 100980273
NCBI-ProteinID: XP_003814175
Position
19
AA seq 921 aa
MAPLALVGVTLLLAAPPCSGAATPTPSLPPPPANDSDTITGGCQGSYRCQPGVLLPVWEP
DDPSLGDKAARAVVYFVAMVYMFLGVSIIADRFMAAIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
IYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLVFFPVCV
VFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGAEAPGELGGLGX
GPAEARELDASRREVIQILKDLKQKHPDKDLEQLVGIANYYALLHQQKSRAFYRIQATRL
MTGAGNVLRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQG
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFV
RLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGT
VDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEE
YEKKDNFFIELGQPQWLKRGISALLLNQGDGDRKLTAEEEEARRIAEMGKPVLGENCRLE
VIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAITVSAGDEEEEEDGSREERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVSILVIGLLTALIGDLASHFGCTVGLK
DSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY
WAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFL
GLWLLYILFASLEAYCHIRGF
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggctcccctggccttggtgggggtcacactcctcctggcggctcccccatgctccggg
gcagccaccccaaccccctccctgccgcctcccccggccaatgacagcgacaccatcaca
gggggctgccaggggtcctaccgctgccagccgggggtgctgctgcccgtgtgggagccc
gacgacccgtcgctgggtgacaaggcggcacgggcagtggtgtactttgtggccatggtc
tacatgtttctgggagtgtccatcatcgccgaccgtttcatggcggccatcgaggtcatc
acgtcaaaagagaaggagatcaccatcaccaaggccaacggtgagaccagcgtgggcacc
gttcgcatctggaatgagacggtgtccaacctcacgctcatggccctgggttcctccgca
cctgagatcctgctgtcagtcatcgaagtctgcggccacaacttccaggcgggtgagctg
ggcccaggcaccatcgtgggcagcgctgccttcaacatgtttgtggtcatcgccgtgtgc
atctacgtcatcccagccggcgagagccgcaagatcaagcacctgagagtcttctttgtc
actgcctcttggagcatcttcgcctatgtctggctttatctcatccttgctgttttttcc
cccggtgtggtccaggtgtgggaggcgctgctgaccctggtcttcttcccggtgtgcgtg
gtattcgcctggatggccgacaagcggctgctcttctacaagtacgtgtacaagcgctac
cgcaccgacccacgcagcggcatcatcataggcgccgagggcgaccccccgaagagcatc
gagctggacggcacgttcgtgggcgccgaggccccaggtgagctgggcggcctgggcncc
gggcccgccgaggcgcgcgagctggacgccagccgccgcgaggtcatccagatcctcaag
gacctcaagcagaagcacccggacaaggatctggagcagctggtgggcatcgccaactac
tacgcgctgctgcaccagcagaagagccgcgccttctaccgcatccaggccacgcggctg
atgaccggcgccgggaacgtgctgcgcagacacgcggcggacgcctcgcgcagggcggcg
ccggccgagggcgcgggcgaggacgaagacgacggcgccagccgcatcttcttcgagcct
agcctctaccactgcctggagaactgcggctccgtgctgctgtccgtcacgtgccagggc
ggcgagggcaacagcaccttctacgtggactaccgcactgaggacggctcggccaaggcg
ggctccgactacgagtacagcgagggcacgctggtgttcaaaccaggcgagacgcagaag
gagctgcgcatcggcatcatcgacgacgacatcttcgaggaggacgagcatttcttcgtg
cggctgctgaacctgcgcgtgggcgacgcgcagggcatgttcgagccggacggcggcggg
cggcccaaggggcggctggtggcgccgctgctggccaccgtcaccatactggacgacgac
cacgcaggcatcttctccttccaggaccgcctgctgcacgtgagcgagtgcatgggcacc
gtggacgtgcgcgtcgtgcgcagctcgggcgcgcgcggcaccgtgcgccttccctaccgc
acggtggacggcacggcgcgcggcggcggcgtgcactacgaggacgcgtgcggagagctg
gagtttggcgacgacgagaccatgaaaactcttcaggtgaagatagttgatgacgaggaa
tatgagaaaaaggataatttcttcattgagctgggccagccccagtggcttaagcgaggg
atttcagctctgctactcaatcaaggggatggggacaggaagctaacagccgaggaggag
gaggctcggaggatagcagagatgggcaagccagttcttggggaaaactgccggctggag
gtcatcatcgaggagtcatatgattttaagaacacggtggataaactcatcaagaaaacg
aacttggccttggtaattgggacccattcatggagggagcagtttttagaggcaattacg
gtgagcgcaggggacgaggaggaggaggaggacgggtcccgggaggagcggctgccttcg
tgctttgactacgtgatgcacttcctgacggtgttctggaaggtgctctttgcctgtgtg
ccccccaccgagtactgccacggctgggcctgctttggcgtctccatcctggtcatcggc
ctgctcaccgccctcattggggacctcgcctcccacttcggctgcaccgttggcctcaag
gactctgtcaatgctgttgtcttcgttgccctgggcacctccatccctgacacgttcgcc
agcaaggtggcggcgctgcaggaccagtgcgccgacgcttccatcggcaacgtgaccggc
tccaacgcggtgaacgtgttcctgggcctgggcgtcgcctggtctgtggctgccgtgtac
tgggcggtgcagggccgccccttcgaggtgcgcactggcacgctggccttctccgtcacg
ctcttcaccgtcttcgccttcgtgggcattgccgtgctgctgtaccggcgccggccgcac
atcggcggcgagctgggcggcccgcgcggacccaagctcgccaccaccgcgctcttcctg
ggcctctggctcctgtacatcctcttcgccagcctggaggcgtactgccacatccggggc
ttctag

KEGG   Pan paniscus (bonobo): 100986811
Entry
100986811         CDS       T02283                                 

Gene name
SLC8A3
Definition
(RefSeq) solute carrier family 8 member A3
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04260  Cardiac muscle contraction
pps04261  Adrenergic signaling in cardiomyocytes
pps04371  Apelin signaling pathway
pps04740  Olfactory transduction
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04974  Protein digestion and absorption
pps04978  Mineral absorption
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100986811 (SLC8A3)
   04020 Calcium signaling pathway
    100986811 (SLC8A3)
   04022 cGMP-PKG signaling pathway
    100986811 (SLC8A3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100986811 (SLC8A3)
   04261 Adrenergic signaling in cardiomyocytes
    100986811 (SLC8A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    100986811 (SLC8A3)
   04978 Mineral absorption
    100986811 (SLC8A3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100986811 (SLC8A3)
  09157 Sensory system
   04740 Olfactory transduction
    100986811 (SLC8A3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100986811 (SLC8A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100986811 (SLC8A3)
   05414 Dilated cardiomyopathy
    100986811 (SLC8A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100986811 (SLC8A3)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100986811 (SLC8A3)
Transporters [BR:pps02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   100986811 (SLC8A3)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Others
   100986811 (SLC8A3)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 100986811
NCBI-ProteinID: XP_003824153
Position
14
AA seq 921 aa
MAWLRLQPLTSAFLHFGLVTFVLFLNGLRAEAGGSGDVPSTGQNNESCSGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFITAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGN
LVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVR
KGGDMSKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNVRIEEEQPEEGMPPAIFNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIH
VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRV
KIVDEEEYERQENFFIALGEPKWMERGISDVTDRKLTMEEEEARRIAEMGKPVLGEHPKL
EVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDESGEERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHFGCTIGLK
DSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIY
WALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFV
SLWLLYILFATLEAYCYIKGF
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggcgtggttaaggttgcagcctctcacctctgccttcctccattttgggctggttacc
tttgtgctcttcctgaatggtcttcgagcagaggctggtggctcaggggacgtgccaagc
acagggcagaacaatgagtcctgttcagggtcatcggactgcaaggagggtgtcatcctg
ccaatctggtacccggagaacccttcccttggggacaagattgccagggtcattgtctat
tttgtggccctgatatacatgttccttggggtgtccatcattgctgaccgcttcatggca
tctattgaagtcatcacctctcaagagagggaggtgacgattaagaaacccaatggagaa
accagcacaaccactattcgggtctggaatgaaactgtctccaacctgacccttatggcc
ctgggttcctctgctcctgagatactcctctctttaattgaggtgtgtggtcatgggttc
attgctggtgatctgggaccttctaccattgtagggagtgcagccttcaacatgttcatc
atcattggcatctgtgtctacgtgatcccagacggagagactcgcaagatcaagcaccta
cgagtcttcttcatcaccgctgcttggagtatctttgcctacatctggctctatatgatt
ctggcagtcttctcccctggtgtggtccaggtttgggaaggcctcctcactctcttcttc
tttccagtgtgtgtccttctggcctgggtggcagataaacgactgctcttctacaaatac
atgcacaaaaagtaccgcacagataaacaccgaggaattatcatagagacagagggtgac
caccctaagggcattgagatggatgggaaaatgatgaattcccattttctagatgggaac
ctggtgcccctggaagggaaggaagtggatgagtcccgcagagagatgatccggattctc
aaggatctgaagcaaaaacacccagagaaggacttagatcagctggtggagatggccaat
tactatgctctttcccaccaacagaagagccgcgccttctaccggatccaagccactcgt
atgatgactggtgcaggcaatatcctgaagaaacatgcagcagaacaagccaagaaggcc
tccagcatgagcgaggtgcacaccgatgagcctgaggactttatttccaaggtcttcttt
gacccatgttcttaccagtgcctggagaactgtggggctgtactcctgacagtggtgagg
aaagggggagacatgtcaaagaccatgtatgtggactacaaaacagaggatggttctgcc
aatgcaggggctgactatgagttcacagagggcacggtggttctgaagccaggagagacc
cagaaggagttctccgtaggcataattgatgacgacatttttgaggaggatgaacacttc
tttgtaagattgagcaatgtccgcatagaggaggagcagccagaggaggggatgcctcca
gcaatattcaacagtcttcccttgcctcgggctgtcctagcctccccttgtgtggccaca
gttaccatcttggatgatgaccatgcaggcatcttcacttttgaatgtgatactattcat
gtcagtgagagtattggtgttatggaggtcaaggttctgcggacatcaggtgcccggggt
acagtcatcgtcccctttaggacagtagaagggacagccaagggtggcggtgaggacttt
gaagacacatatggggagttggaattcaagaatgatgaaactgtgaaaaccataagggtt
aaaatagtagatgaggaggaatacgaaaggcaagagaatttcttcattgcccttggtgaa
ccgaaatggatggaacgtggaatatcagatgtgacagacaggaagctgactatggaagaa
gaggaggccaggaggatagcagagatgggaaagccagtattgggtgaacaccccaaacta
gaagtcatcatcgaagagtcctatgagttcaagactacggtggacaaactgatcaagaag
acaaacctggccttggttgtggggacccattcctggagggaccagttcatggaggccatc
accgtcagtgcagcaggggatgaggatgaggatgaatccggggaggagaggctgccctcc
tgctttgactacgtcatgcacttcctgactgtcttctggaaggtgctgtttgcctgtgtg
ccccccacagagtactgccacggctgggcctgcttcgccgtctccatcctcatcattggc
atgctcaccgccatcattggggacctggcctcgcacttcggctgcaccattggtctcaaa
gattcagtcacagctgttgttttcgtggcatttggcacctctgtcccagatacgtttgcc
agcaaagctgctgccctccaggatgtatatgcagacgcctccattggcaacgtgacgggc
agcaacgccgtcaatgtcttcctgggcatcggcctggcctggtccgtggccgccatctac
tgggctctgcagggacaggagttccacgtgtcggccggcacgctggccttctccgtcacc
ctcttcaccatctttgcatttgtctgcatcagcgtgctcttgtaccgaaggcggccgcac
ctgggaggggagcttggtggcccccgtggctgcaagctcgccacaacatggctctttgtg
agcctgtggctcctctacatactctttgccacactagaggcctattgctacatcaagggg
ttctaa

DBGET integrated database retrieval system