KEGG   Pan paniscus (bonobo): 100969937
Entry
100969937         CDS       T02283                                 

Gene name
STIM2
Definition
(RefSeq) stromal interaction molecule 2
  KO
K18196  stromal interaction molecule 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100969937 (STIM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100969937 (STIM2)
Transporters [BR:pps02000]
 Other transporters
  Pores ion channels [TC:1]
   100969937 (STIM2)
SSDB
Motif
Pfam: SOAR SAM_2 SAM_1 DUF4446 SAM_Ste50p
Other DBs
NCBI-GeneID: 100969937
NCBI-ProteinID: XP_008950446
Position
4
AA seq 701 aa
MSLSPPCFTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLH
REDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAV
HEPSFMISQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTVSIVIGVGGCWF
AYTQNKTSKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVAVEKQNLERKMMDE
INYAKEEACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFELRSSWSVPDALQK
WLQLTHEVEVQYYNIKRQNAEMQLAIAKDEVAASYLIQAEKIKKKRSTVFGTLHVAHSSS
LDEVDHKILEAKKALSELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWV
VMPRVSIPPYPIAGGVDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQ
PQRAQLAPHAPHPSHPRHPHHPQHTPHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAE
KQWEVPDTASECDSLNSSIGRKQSPPLSLEIYQTLSPRKISRDEVSLEDSSRGDSPVTVD
VSWGSPDCVGLTETKSMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSSAGNDS
KPVQEAPSVARISSIPHDLCHNGEKSKKPSKIKSLFKKKSK
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgtcactgagtccaccatgctttacagaagaagacagatttagtctggaagctcttcaa
acaatacataaacaaatggatgatgacaaagatggtggaattgaagtagaggaaagtgat
gaattcatcagagaagatatgaaatataaagatgctactaataaacacagccatctgcac
agagaagataaacatataacgattgaggatttatggaaacgatggaaaacgtcagaagtt
cataattggacccttgaagacactcttcagtggttgatagagtttgttgaactaccccaa
tatgagaagaattttagagacaacaatgtcaaaggaacgacacttcccaggatagcagtg
cacgaaccttcatttatgatctcccagttgaaaatcagtgaccggagtcacagacaaaaa
cttcagctcaaggcattggatgtggttttgtttggacctctaacacgcccacctcataac
tggatgaaagattttatcctcacagtttctatagtaattggtgttggagggtgctggttt
gcttatacgcagaataagacatcaaaagaacatgttgcaaaaatgatgaaagatttagag
agcttacaaactgcagagcaaagtctaatggacttacaagagaggcttgaaaaggcacag
gaagaaaacagaaatgttgctgtagaaaagcaaaatttagagcgcaaaatgatggatgaa
atcaattatgcaaaggaggaggcttgtcggctgagagagctaagggagggagctgaatgt
gaattgagtagacgtcagtatgcagaacaggaattggaacaggttcgcatggctctgaaa
aaagccgaaaaagaatttgaactgagaagcagttggtctgttccagatgcacttcagaaa
tggcttcagttaacacatgaagtagaagtgcaatactacaatattaaaagacaaaacgct
gaaatgcagctagctattgctaaagatgaggttgctgcttcatatctgattcaggcagaa
aaaattaaaaagaagagaagcacagtctttgggactctgcacgttgcacacagctcctcc
ctagatgaggtagaccacaaaattctggaagcaaagaaagctctctctgagttgacaact
tgtttacgagaacgactttttcgctggcaacaaattgagaagatctgtggctttcagata
gcccataactcaggactccccagcctgacctcttccctttattctgatcacagctgggtg
gtgatgcccagagtctccattccaccctatccgattgctggaggagttgatgacttagat
gaagacacacccccaatagtgtcacaatttcccgggaccatggctaaacctcctggatca
ttagccagaagcagcagcctgtgccgttcacgccgcagcattgtgccgtcctcgcctcag
cctcagcgagctcagcttgctccacacgccccccacccgtcacaccctcggcaccctcac
cacccccaacacacaccacactccttgccttcccctgatccagatatcctctcagtgtca
agttgccctgcgctttatcggaatgaagaggaggaagaggccatttacttctctgctgaa
aagcaatgggaagtgccagacacagcttcagaatgtgactccttaaattcttccattgga
aggaaacagtctcctcctttaagcctcgagatataccaaacattatctccgcgaaagata
tcaagagatgaggtgtccctagaggattcctcccgaggggattcacctgtaactgtggat
gtgtcttggggttctcccgactgtgtaggtctgacagaaactaagagtatgatcttcagt
cctgcaagcaaagtgtacaatggcattttggagaaatcctgtagcatgaaccagctttcc
agtggcatcccggtgcctaaacctcgccacacatcatgttcctcagctggcaacgacagt
aaaccagttcaggaagccccaagtgttgccagaataagcagcatcccacatgacctttgt
cataatggagagaaaagcaaaaagccatcaaaaatcaaaagcctttttaagaagaaatct
aagtga

KEGG   Pan paniscus (bonobo): 100990966
Entry
100990966         CDS       T02283                                 

Gene name
STIM1
Definition
(RefSeq) stromal interaction molecule 1
  KO
K16059  stromal interaction molecule 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100990966 (STIM1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100990966 (STIM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100990966 (STIM1)
Transporters [BR:pps02000]
 Other transporters
  Pores ion channels [TC:1]
   100990966 (STIM1)
SSDB
Motif
Pfam: SOAR SAM_2 SAM_1 SAM_Ste50p
Other DBs
NCBI-GeneID: 100990966
NCBI-ProteinID: XP_008960164
Position
11
AA seq 685 aa
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSED
EKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDL
WKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLK
MTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEH
MKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRL
KELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQ
YYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT
AALRERLHRWQQIEILCGFQIVNNPGIHSLVTALNIDPSWMGSTRPNPAHFIMTDDVDDM
DEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQM
SRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELS
PSAPPGGSPHLDSSRSYSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGS
IGEETDSSPGRKKFPLKIFKKPLKK
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggatgtatgcgtccgtcttgccctgtggctcctctggggactcctcctgcaccagggc
cagagcctcagccatagtcacagtgagaaggcgacaggaaccagctcgggggccaactct
gaggagtccactgcagcagagttttgccgaattgacaagcccctatgtcacagtgaggat
gagaaactcagcttcgaggcagtccgtaacatccacaaactgatggacgatgatgccaat
ggtgatgtggatgtggaagaaagtgatgagttcctgagggaggacctcaattaccatgac
ccaacagtgaaacacagcaccttccatggtgaggataagctcatcagcgtggaggacctg
tggaaggcatggaagtcatcagaagtatacaattggaccgtggatgaggtggtacagtgg
ctgatcacatatgtggagctgcctcagtatgaggagaccttccggaagctgcagctcagt
ggccatgccatgccaaggctggctgtcaccaacaccaccatgacagggactgtgctgaag
atgacagaccggagtcatcggcagaagctgcagctgaaggccctggatacagtgctcttt
gggcctcctctcttgactcgccataatcacctcaaggacttcatgctggtggtgtctatc
gttattggtgtgggcggctgctggtttgcctatatccagaaccgttactccaaggagcac
atgaagaagatgatgaaggacttggaggggttacaccgagctgagcagagtctgcatgac
cttcaggaaaggctgcacaaggcccaggaggagcaccgcacagtggaggtggagaaggtc
catctggaaaagaagctgcgcgatgagatcaaccttgctaagcaggaagcccagcggctg
aaggagctgcgggagggtactgagaatgagcggagccgccaaaagtatgctgaggaggag
ttggagcaggttcgggaggccttgaggaaagcagagaaggagctagaatctcacagctca
tggtatgctccagaggcccttcagaagtggctgcagctgacacatgaggtggaggtgcaa
tattacaacatcaagaagcaaaatgctgagaagcagctgctggtggccaaggagggggct
gagaagataaaaaagaagagaaacacactctttggtaccttccacgtggcccacagctct
tccctggatgatgtagatcataaaattctaacagctaagcaagcactgagcgaggtgaca
gcagcattgcgggagcgcctgcaccgctggcaacagatcgagatcctctgtggcttccag
attgtcaacaaccctggcatccactcactggtgactgccctcaacatagaccccagctgg
atgggcagtacacgccccaaccctgctcacttcatcatgactgacgacgtggatgacatg
gatgaggagattgtgtctcccttgtccatgcagtcccctagcctgcagagcagtgttcgg
cagcgcctgacggagccacagcatggcctgggatctcagagggatttgacccattccgat
tcggagtcctccctccacatgagtgaccgccagcgtgtggcccccaaacctcctcagatg
agccgtgctgcagacgaggctctcaatgccatgacttccaatggcagccaccggctgatc
gagggggtgcacccagggtctctggtggagaaactgcctgacagccctgccctggccaag
aaggcattactggcgctgaaccatgggctggacaaggcccacagcctgatggagctgagc
ccctcagccccacctggtggctctccacatttggattcttcccgttcttacagccccagc
tccccagacccagacacgccatctccagttggggacagccgagccctgcaagccagccga
aacacacgcattccccacctggctggcaagaaggctgtggctgaggaggataatggctct
attggcgaggaaacagactccagcccaggccggaagaagtttcccctcaaaatctttaag
aagcctcttaagaagtag

DBGET integrated database retrieval system