KEGG   Pan paniscus (bonobo): 100970270
Entry
100970270         CDS       T02283                                 

Gene name
P2RX3
Definition
(RefSeq) purinergic receptor P2X 3
  KO
K05217  P2X purinoceptor 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100970270 (P2RX3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100970270 (P2RX3)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    100970270 (P2RX3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100970270 (P2RX3)
Ion channels [BR:pps04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   100970270 (P2RX3)
SSDB
Motif
Pfam: P2X_receptor
Other DBs
NCBI-GeneID: 100970270
NCBI-ProteinID: XP_003826484
UniProt: A0A2R9BII3
Position
3
AA seq 397 aa
MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERFPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgaactgcatatccgacttcttcacctatgagaccaccaagtcggtggttgtgaagagc
tggaccatcgggatcatcaaccgagtagttcagcttctgatcatctcctactttgtaggg
tgggttttcttgcacgagaaggcttaccaggtacgggacacagccattgagtcctcggtg
gtaaccaaggtgaagggctccggactctacgccaacagagtcatggatgtgtctgattac
gtgacgccacctcagggcacctcggtctttgtcatcatcaccaagatgattgttactgaa
aatcagatgcaaggattctgcccagagagtgaggagaaataccgctgtgtatcagacagc
cagtgcgggcctgagcgcttcccaggtggggggatcctcactggccgctgcgtgaactac
agctctgtgctccggacctgtgagatacagggctggtgccccacggaggtggacacggtg
gaaacgcccatcatgatggaagctgagaacttcactattttcatcaagaacagcatccgt
ttccccctcttcaactttgagaagggaaacctccttcccaacctgacagccagggacatg
aagacctgccgcttccacccggacaaggaccctttctgccccatcttgcgggtaggggac
gtggtcaagtttgcggggcaggattttgccaaactggcgcgcacggggggagttctgggc
attaagatcggctgggtgtgcgacttggacaaggcctgggaccagtgcatccccaaatac
tccttcacccggctcgacagcgtttctgagaaaagcagcgtgtccccaggctacaacttc
aggtttgccaagtactacaaaatggagaatggcagtgagtaccgcaccctcctgaaggct
tttggcatccgcttcgacgtgctggtatacgggaatgctggcaagttcaacatcatcccc
accatcatcagctctgtggcggcctttacttctgtgggagtgggaactgttctctgtgac
atcatcctgctcaacttcctcaagggggccgaccagtacaaagccaagaagtttgaggag
gtgaatgagactacgctgaaaatcgcggctttgaccaacccagtgtaccccagcgaccag
accacagcagagaagcagtccaccgattcgggggccttctccataggccactag

KEGG   Pan paniscus (bonobo): 100973505
Entry
100973505         CDS       T02283                                 

Gene name
P2RX2
Definition
(RefSeq) purinergic receptor P2X 2
  KO
K05216  P2X purinoceptor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100973505 (P2RX2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100973505 (P2RX2)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    100973505 (P2RX2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100973505 (P2RX2)
Ion channels [BR:pps04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   100973505 (P2RX2)
SSDB
Motif
Pfam: P2X_receptor
Other DBs
NCBI-GeneID: 100973505
NCBI-ProteinID: XP_008965607
Position
12
AA seq 476 aa
MDFEEAFSQRTVVPLMNLNVSTCCERERGPQPGVPPGGALAAQPRSSVGVRRSGGIALRV
VSGQAVLIVSPMPGRRCPHHSDRPRQDVRVTREVGPPLLKTSLVADSCVDIQQPYLFPVA
SGAGAAPARRYVFIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVF
SIITRVEATHSQTQRTCPESIRVHNATCLSDADCVAGELNMLGNGLRTGRCVPYYQGPSK
TCEVFGWCPVEDGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTF
HEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRL
DPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATA
LTSVGVGSFLCDWILLTFMNKNKVYSHKKFDKMVDTPASEPAQASTPTDPKGLAQL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggattttgaagaagccttttcccagcggacagtggttcccctgatgaatttgaacgtg
agcacctgctgtgagcgggagcgggggcctcagcctggggtccctcctggaggggccctt
gctgcccagccccgcagcagcgtgggcgtcagacgaagcggcggcattgccctgcgtgtg
gtcagcggccaagctgtgctcattgtgagccccatgcccggacggcgctgcccccaccac
agcgaccggcccagacaggacgtgcgagtgactcgtgaggttgggcctcccttgctgaaa
acttccctggtggctgacagctgcgtggacattcagcagccctacctttttccggtcgcc
tccggagccggcgccgcccctgcccgcaggtacgtattcatcgtgcagaaaagctaccag
gagagcgagacgggccccgagagctccatcatcaccaaggtcaaggggatcaccacgtcc
gagcacaaagtgtgggacgtggaggagtatgtgaagccccccgaggggggcagcgtgttc
agcatcatcaccagggtggaggccacccactcccagacccagagaacctgccccgagagc
ataagggtccacaacgccacctgcctctccgacgccgactgcgtggctggggagctgaac
atgctgggaaacggcctgaggaccgggcgctgtgtgccctattaccaggggccctccaag
acctgcgaggtgttcggctggtgcccggtggaagatggggcctctgtcagccaatttctg
ggtacgatggccccaaatttcaccatcctcatcaagaacagcatccactaccccaaattc
cacttctccaagggcaacatcgccgaccgcacagatgggtacctgaagcgctgcacgttc
cacgaggcctccgacctctactgccccatcttcaagctgggctttatcgtggagaaggct
ggggagagcttcacagagctcgcacacaagggtggtgtcattggggtcattatcaactgg
gactgtgacctggacctgcctgcatcggagtgcaaccccaagtactccttccggaggctt
gaccccaagcacgtgcctgcctcgtcaggctacaacttcaggtttgccaaatactacaag
atcaatggcaccaccacccgcacgctcatcaaggcctacgggatccgcattgacgtcatt
gtgcatggacaggccgggaagttcagcctgattcccaccattattaatctggccacagct
ctgacttccgtcggggtgggctccttcctgtgcgactggatcttgctaacattcatgaac
aaaaacaaggtctacagccataagaaatttgacaagatggtggacactcctgcctccgag
cctgcccaagcctccacacccacagaccccaaaggtttggctcaactctga

KEGG   Pan paniscus (bonobo): 100976042
Entry
100976042         CDS       T02283                                 

Gene name
P2RX6
Definition
(RefSeq) purinergic receptor P2X 6
  KO
K05221  P2X purinoceptor 6
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100976042 (P2RX6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100976042 (P2RX6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100976042 (P2RX6)
Ion channels [BR:pps04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   100976042 (P2RX6)
SSDB
Motif
Pfam: P2X_receptor WAP
Other DBs
NCBI-GeneID: 100976042
NCBI-ProteinID: XP_003806938
UniProt: A0A2R9AU12
Position
22
AA seq 441 aa
MCPQLAGAGSMGSPGATAGWGLLDYKTEKYVMTRNWRVGALQRLLQFGIVVYVVGWALLA
KKGYQERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTP
AQVQGRCPEHPSVPLANCWVDEDCPEGEGGTHSHGVKTGQCVVFNGTHRTCEIWSWCPVE
SGVVPSRPLLAQAQNFTLFIKNTVTFSKFNFSKSNALETWDPTYFKHCRYEPQFSPYCPV
FRIGDLVAKAGGTFEDLALLGGSVGIRVHWDCDLDTGDSGCWPHYSFQLQEKSYNFRTAT
HWWEQPGVEARTLLKLYGIRFDILVTGQAGKFGLIPTAVTLGTGAAWLGVVTFFCDLLLL
YVDREAHFYWRTKYEEAKAPKATTNSVWRELALASQARLAECLRQSSAPAPMATAAGSQT
QTPGWPCPSSDTHLPTHSGSL
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgtgcccgcagctagcaggagctggcagcatgggctccccaggggccacagcaggctgg
gggcttctggattataaaacggagaagtatgtgatgaccaggaactggcgggtgggcgcc
ctgcagaggctgctgcagtttgggatcgtggtctatgtggtagggtgggctctcctcgcc
aaaaaaggctaccaggagcgggacctggaaccccagttttccatcatcaccaaactcaaa
ggggtttccgtcactcagatcaaggagcttggaaaccggctgtgggatgtggccgacttc
gtgaagccacctcagggagagaacgtgttcttcttggtgaccaacttccttgtgacgcca
gcccaagttcagggcagatgcccagagcacccgtccgtcccactggctaactgctgggtc
gacgaggactgccccgaaggggagggaggcacacacagccacggtgtaaaaacaggccag
tgtgtggtgttcaatgggacccacaggacctgtgagatctggagttggtgcccagtggag
agtggcgttgtgccctcgaggcccctgctggcccaggcccagaacttcacactgttcatc
aaaaacacagtcaccttcagcaagttcaacttctctaagtccaatgccttggagacctgg
gaccccacctattttaagcactgccgctatgaaccacaattcagcccctactgtcccgtg
ttccgcattggggacctcgtggccaaggctggagggaccttcgaggacctggcgttgctg
ggtggctctgtgggcatcagagttcactgggattgtgacctggacaccggggactctggc
tgctggcctcactactccttccagctgcaggagaagagctacaacttcaggacagccact
cactggtgggagcaaccgggtgtggaggcccgcaccctgctcaagctctatggaatccgc
tttgacatcctcgtcaccgggcaggcagggaagttcgggctcatccccacggccgtcaca
ctgggcaccggggcagcttggctgggcgtggtcacctttttctgtgacctgctactgctg
tatgtggatagagaagcccatttctactggaggacaaagtatgaggaggccaaggccccg
aaagcaaccaccaactctgtgtggagggagctggcccttgcatcccaagcccgactggcc
gagtgcctcagacagagctcagcacctgcacccatggccactgctgctgggagtcagaca
cagacaccaggatggccctgtccaagttctgacacccacttgccaacccattccggaagc
ctgtag

KEGG   Pan paniscus (bonobo): 100977072
Entry
100977072         CDS       T02283                                 

Gene name
CHRNA7
Definition
(RefSeq) cholinergic receptor nicotinic alpha 7 subunit
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04725  Cholinergic synapse
pps05010  Alzheimer disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05033  Nicotine addiction
pps05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100977072 (CHRNA7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100977072 (CHRNA7)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100977072 (CHRNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100977072 (CHRNA7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100977072 (CHRNA7)
   05022 Pathways of neurodegeneration - multiple diseases
    100977072 (CHRNA7)
  09165 Substance dependence
   05033 Nicotine addiction
    100977072 (CHRNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100977072 (CHRNA7)
Ion channels [BR:pps04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100977072 (CHRNA7)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb SUR7
Other DBs
NCBI-GeneID: 100977072
NCBI-ProteinID: XP_003826096
Position
15
AA seq 502 aa
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcgctgctcgccgggaggcgtctggctggcgctggccgcgtcgctcctgcacgtgtcc
ctgcaaggcgagttccagaggaagctttacaaggagctggtcaagaactacaatcccttg
gagaggcccgtggccaatgactcgcaaccgctcaccgtctacttctccctgagcctcctg
cagatcatggacgtggatgagaagaaccaagttttaaccaccaacatttggctgcaaatg
tcttggacagatcactatttacagtggaatgtgtcagaatatccaggggtgaagactgtt
cgtttcccagatggccagatttggaaaccagacattcttctctataacagtgctgatgag
cgctttgacgccacattccacactaacgtgttggtgaattcttccgggcattgccagtac
ctgcctccaggcatattcaagagttcctgctacatcgatgtacgctggtttccctttgat
gtgcagcactgcaaactgaagtttgggtcctggtcttacggaggctggtccttggatctg
cagatgcaggaggcagatatcagtggctatatccccaatggagaatgggacctagtggga
atccccggcaagaggagtgaaaggttctatgagtgctgcaaagagccctaccccgatgtc
accttcacagtgaccatgcgccgcaggacgctctactatggcctcaacctgctgatcccc
tgtgtgctcatctccgccctcgccctgctggtgttcctgcttcctgcagattccggggag
aagatttccctggggataacagtcttactctctcttactgtcttcatgctgctcgtggct
gagatcatgcctgcaacatccgattcggtaccattgatagcccagtacttcgccagcacc
atgatcatcgtgggcctctcggtggtggtgacagtgatcgtgcttcagtaccaccaccac
gaccccgacgggggcaagatgcccaagtggaccagagtcatccttctgaactggtgcgcg
tggttcctgcgaatgaagaggcccggggaggacaaggtgcgcccggcctgccagcacaag
cagcggcgctgcagcctggccagtgtggagatgagcgccgtggcgccgccgcccgccagc
aacgggaacctgctgtacatcggcttccgcggcctggacggcgtgcactgtgtcccgacc
cccgactctggggtagtgtgtggccgcatggcctgctcccccacgcacgacgagcacctc
ctgcacggtgggcagccccccgagggggacccggacctggccaagatcctggaggaggtc
cgctacattgccaaccgcttccgctgccaggacgaaagcgaggcggtctgcagcgagtgg
aagttcgccgcctgcgtggtggaccgcctgtgcctcatggccttctcggtcttcaccatc
atctgcaccatcggcatcctgatgtcggctcccaacttcgtggaggccgtgtccaaagac
tttgcgtaa

KEGG   Pan paniscus (bonobo): 100977548
Entry
100977548         CDS       T02283                                 

Gene name
GRIN2D
Definition
(RefSeq) glutamate ionotropic receptor NMDA type subunit 2D
  KO
K05212  glutamate receptor ionotropic, NMDA 2D
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04724  Glutamatergic synapse
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05030  Cocaine addiction
pps05031  Amphetamine addiction
pps05033  Nicotine addiction
pps05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100977548 (GRIN2D)
   04024 cAMP signaling pathway
    100977548 (GRIN2D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100977548 (GRIN2D)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100977548 (GRIN2D)
   04720 Long-term potentiation
    100977548 (GRIN2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100977548 (GRIN2D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100977548 (GRIN2D)
   05014 Amyotrophic lateral sclerosis
    100977548 (GRIN2D)
   05017 Spinocerebellar ataxia
    100977548 (GRIN2D)
   05020 Prion disease
    100977548 (GRIN2D)
   05022 Pathways of neurodegeneration - multiple diseases
    100977548 (GRIN2D)
  09165 Substance dependence
   05030 Cocaine addiction
    100977548 (GRIN2D)
   05031 Amphetamine addiction
    100977548 (GRIN2D)
   05033 Nicotine addiction
    100977548 (GRIN2D)
   05034 Alcoholism
    100977548 (GRIN2D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100977548 (GRIN2D)
Ion channels [BR:pps04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100977548 (GRIN2D)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor MatE
Other DBs
NCBI-GeneID: 100977548
NCBI-ProteinID: XP_008965007
Position
19
AA seq 885 aa
VAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLEEYDWT
SFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSVSAQIRL
LFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLAGGGGSGAPGEPPLLPGGAPLPAGLF
AVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESLHRYFM
NITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFLQP
VDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRCCK
GFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTINEE
RSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFIFE
YLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLVWAFF
AVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEKNIRSN
YPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGKVFA
TTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKLDIDNM
AGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYRARRTSLASSP
RYDAAPGAPPPPWSAQATARGGARSGQDPRHVPNGSPAFPCTAMNPTSLKPKLPTLPHLR
TTPLATKHILSKSNPYLRPFSDDPADLQKASSAQISSRRFRTLSD
NT seq 2658 nt   +upstreamnt  +downstreamnt
gtcgcgcccatcctcgacttcctgtcggcgcagacctcgctgcccatcgtggccgtgcac
ggcggcgccgcgctcgtgctcacgcccaaggagaagggctccaccttcctgcagctgggc
tcctccaccgagcaacagcttcaggtcatctttgaggtgctggaggagtatgactggacg
tcctttgtagccgtgaccacgcgtgcccctggccaccgggccttcctgtcctacattgag
gtgctgactgacggtagtctggtgggctgggagcaccgcggagcgctgacgctggaccct
ggggcgggcgaggccgtgctcagtgcccagctccgcagtgtcagcgcgcagatccgcctg
ctcttctgcgcccgagaggaggccgagcccgtgttccgcgcagctgaggaggctggcctc
actggatctggctacgtctggttcatggtggggccccagctggctggaggcgggggctct
ggggcccctggtgagccccctcttctgccaggaggcgcccccctgcctgccgggctgttt
gcagtgcgctcggctggctggcgggatgacctggctcggcgagtggcagctggcgtggcc
gtagtggccagaggtgcccaggccctgctgcgtgattatggtttccttcctgagctcggc
cacgactgtcgcgcccagaaccgcacccaccgcggcgagagtctgcataggtacttcatg
aacatcacgtgggataaccgggattactccttcaatgaggacggcttcctagtgaacccc
tccctggtggtcatctccctcaccagagacaggacgtgggaggtggtgggcagctgggag
cagcagacgctccgcctcaagtacccactgtggtcccgctatggtcgcttcctgcagcca
gtggacgacacgcagcacctcacggtggccacgctggaggaaaggccgtttgtcatcgtg
gagcctgcagaccccatcagcggcacctgcatccgagactccgtcccctgccggagccag
ctcaaccgaacccacagccctccaccggatgccccccgcccggaaaagcgctgctgcaag
ggtttctgcatcgacattctgaagcggctggcgcataccatcggcttcagctacgacctc
tacctggtcaccaatggcaagcacggaaagaagatcgatggcgtctggaacggcatgatc
ggggaggtgttctaccagcgcgcagacatggccatcggctccctcaccatcaacgaggag
cgctccgagatcgtggacttctccgtccccttcgtggagaccggcatcagcgtcatggtg
gcgcgcagcaatggcacggtgtccccctcggccttcctcgagccctacagccccgccgtg
tgggtgatgatgttcgtcatgtgcctcactgtggtcgccgtcactgttttcatcttcgag
tacctcagtcctgttggctacaaccgcagcctggccacgggcaagcgccctggcggctca
accttcaccattgggaaatccatctggctgctctgggccctggtgttcaataattcggtg
cccgtggagaacccccggggaaccaccagcaaaatcatggtgctggtgtgggccttcttc
gccgtcatcttcctcgccagctacacagccaacctggccgccttcatgatccaggaggag
tacgtggatactgtgtctgggctcagtgaccgcaagttccagaggccccaggagcagtac
ccgcccctgaagtttgggaccgtgcccaacggctccacggagaagaacatccgcagcaac
tatcccgacatgcacagctacatggtgcgctacaaccagccccgcgtagaggaagcgctc
actcagctcaaggcagggaagctggacgccttcatctacgatgctgcagtgctcaattac
atggcccgcaaggacgagggctgcaagcttgtcaccatcggctccggcaaggtcttcgcc
acgacaggctatggcatcgccctgcacaagggctcccgctggaagcggcccatcgacctg
gcgttgctgcagttcctgggggatgatgagatcgagatgctggagcggctgtggctctct
gggatctgccacaatgacaaaatcgaggtgatgagcagcaagctggacatcgacaacatg
gcgggcgtcttctacatgctcctggtggccatgggcctgtccctgctggtcttcgcctgg
gagcacctggtgtactggcgcctgcggcactgcctggggcccacccaccgcatggacttc
ctgctggccttctccaggggcatgtacagggctcggcgcacttctctagcctcgagtccg
aggtatgacgcggccccgggggccccaccgcccccttggtcagcgcaggccacggcccga
gggggcgcccgcagtggacaggacccgcgacacgtccccaacggaagccccgccttccct
tgcaccgcgatgaacccaacctccctgaagccaaaacttcccaccctgccgcacctccgg
accaccccacttgccaccaagcacatcctctccaaatccaacccttatttgcgacccttc
agtgatgacccagcagacctccaaaaagcctcctctgcccagatctccagccggcgtttc
cgcaccctctccgattag

KEGG   Pan paniscus (bonobo): 100977852
Entry
100977852         CDS       T02283                                 

Gene name
GRIN2A
Definition
(RefSeq) glutamate ionotropic receptor NMDA type subunit 2A
  KO
K05209  glutamate receptor ionotropic, NMDA 2A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04724  Glutamatergic synapse
pps04728  Dopaminergic synapse
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05030  Cocaine addiction
pps05031  Amphetamine addiction
pps05033  Nicotine addiction
pps05034  Alcoholism
pps05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100977852 (GRIN2A)
   04015 Rap1 signaling pathway
    100977852 (GRIN2A)
   04020 Calcium signaling pathway
    100977852 (GRIN2A)
   04024 cAMP signaling pathway
    100977852 (GRIN2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100977852 (GRIN2A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100977852 (GRIN2A)
   04728 Dopaminergic synapse
    100977852 (GRIN2A)
   04720 Long-term potentiation
    100977852 (GRIN2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100977852 (GRIN2A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100977852 (GRIN2A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100977852 (GRIN2A)
   05014 Amyotrophic lateral sclerosis
    100977852 (GRIN2A)
   05017 Spinocerebellar ataxia
    100977852 (GRIN2A)
   05020 Prion disease
    100977852 (GRIN2A)
   05022 Pathways of neurodegeneration - multiple diseases
    100977852 (GRIN2A)
  09165 Substance dependence
   05030 Cocaine addiction
    100977852 (GRIN2A)
   05031 Amphetamine addiction
    100977852 (GRIN2A)
   05033 Nicotine addiction
    100977852 (GRIN2A)
   05034 Alcoholism
    100977852 (GRIN2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100977852 (GRIN2A)
Ion channels [BR:pps04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100977852 (GRIN2A)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 100977852
NCBI-ProteinID: XP_003808342
UniProt: A0A2R9AYV3
Position
16
AA seq 1464 aa
MGRVGYWTLLVLPALLVWRGPAPSAAAEKGPPALNIAVMLGHSHDVTERELRTLWGPEQA
AGLPLDVNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSHT
FVPILGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGY
REFISFVKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGIGILT
TAASSMLEKFSYIPEAKASCYGQMERPEVPMHTLHPFMVNVTWDGKDLSFTEEGYQVHPR
LVVIVLNKDREWEKVGKWENHTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLV
TNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRS
NGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFT
IGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVD
QVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSL
KTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALL
QFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRS
AKNISNMSNMNSSRMDSPKRAADFIQRGSLIMDMVSDKGNLMYSDNRSFQGKESIFGDNM
NELQTFVANRQKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKVNSRPRQLWKKSVDS
IRQDSLSQNPVSQRDEATAENRTHSLKSPRYLPEEMAHSDISETSNRATCHREPDNSKNH
KTKDNFKRSVASKYPKDCSEVERTYLKTKSSSPRDKIYTIDGEKEPGFHLDPPQFVENVT
LPENVDFPDPYQDPSENLRKGDSTLPMNRNPLQNEEGLSNNDQYKLYSKHFTLKDKGSPH
SETSERYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP
ATGEQVYQQDWAQNNALQLQKNKLRISRQHSYDNIVDKPRELDLSRPSRSISLKDRERLL
EGNFYGSLFSVPSSKLSGKKTSLFPQGLEDSKRSKSLLPDHTSDNPFLHSHRDDQRLVIG
RCPSDPYKHSLPSQAVNDSYLRSSLRSTASYCSRDSRGHNDVYISEHVMPYAANKNNMYS
TPRVLNSCSNRRVYKKMPSIESDV
NT seq 4395 nt   +upstreamnt  +downstreamnt
atgggcagagtgggctattggaccctgctggtgctgccggcccttctggtctggcgcggt
ccggcgccgagcgcggcggcggagaagggtccccccgcgctaaatattgcggtgatgctg
ggtcacagccacgacgtgacagagcgcgaacttcgaacactgtggggccccgagcaggcg
gcggggctgcccctggacgtgaacgtggtagctctgctgatgaaccgcaccgaccccaag
agcctcatcacgcacgtgtgcgacctcatgtccggggcacgcatccacggcctcgtgttt
ggggacgacacggaccaggaggccgtagcccagatgctggattttatctcctcccacacc
ttcgtccccatcttgggcattcatgggggcgcatctatgatcatggctgacaaggatccg
acgtctaccttcttccagtttggagcgtccatccagcagcaagccacggtcatgctgaag
atcatgcaggattatgactggcatgtcttctccctggtgaccaccatcttccctggctac
agggaattcatcagcttcgtcaagaccacagtggacaacagctttgtgggctgggacatg
cagaatgtgatcacactggacacttcctttgaggatgcaaagacacaagtccagttgaag
aagatccactcttctgtcatcttgctctactgttccaaagacgaggctgttctcattctg
agtgaggcccgctcccttggcctcaccgggtatgatttcttctggattgtccccagcttg
gtctctgggaacacggagctcatcccaaaagagtttccatcgggactcatttctgtctcc
tacgatgactgggactacagcctggaggcgagagtgagggacggcattggcatcctaacc
accgctgcatcttctatgctggagaagttctcctacatccccgaggccaaggccagctgc
tacgggcagatggagaggccagaggtcccgatgcacaccttgcacccatttatggtcaat
gttacatgggatggcaaagacttatccttcactgaggaaggctaccaggtgcaccccagg
ctggtggtgattgtgctgaacaaagaccgggaatgggaaaaggtgggcaagtgggagaac
catacgctgagcctgaggcacgccgtgtggcccaggtacaagtccttctccgactgtgag
ccggatgacaaccatctcagcatcgtcaccctggaggaggccccattcgtcatcgtggaa
gacatagaccccctgaccgagacgtgtgtgaggaacaccgtgccatgtcggaagttcgtc
aaaatcaacaattcaaccaatgaggggatgaatgtgaagaaatgctgcaaggggttctgc
attgatattctgaagaagctttccagaactgtgaagtttacttacgacctctatctggtg
accaatgggaagcatggcaagaaagttaacaatgtgtggaatggaatgatcggtgaagtg
gtctatcaacgggcagtcatggcagttggctcgctcaccatcaatgaggaacgttctgaa
gtggtggacttctctgtgccctttgtggaaacgggaatcagtgtcatggtttcaagaagt
aatggcaccgtctcaccttctgcttttctagaaccattcagcgcctctgtctgggtgatg
atgtttgtgatgctgctcattgtttctgccatagctgtttttgtctttgaatacttcagc
cctgttggatacaacagaaacttagccaaagggaaagcaccccatgggccttcttttaca
attggaaaagctatatggcttctttggggcctggtgttcaataactccgtgcctgtccag
aatcctaaagggaccaccagcaagatcatggtatctgtatgggccttcttcgctgtcata
ttcctggctagctacacagccaatctggctgccttcatgatccaagaggaatttgtggac
caagtgactggcctcagtgacaaaaagtttcagagacctcatgactattccccacctttt
cgatttgggacagtgcctaatggaagcacggagagaaacattcggaataactatccctac
atgcatcagtacatgaccaaatttaatcagaaaggagtagaggacgccttggtcagcctg
aaaacggggaagctggacgctttcatctacgatgccgcagtcttgaattacaaggctggg
agggatgaaggctgcaagctggtgaccatcgggagtgggtacatctttgccaccaccggt
tatggaattgcccttcagaaaggctctccttggaagaggcagattgacctggccttgctt
cagtttgtgggtgatggtgagatggaggagctggagaccctgtggctcactgggatctgc
cacaacgagaagaacgaggtgatgagcagccagctggacattgacaacatggcgggcgta
ttctacatgctggctgccgccatggcccttagcctcatcaccttcatctgggagcacctc
ttctactggaagctgcgcttctgtttcacaggcgtgtgctccgaccggcctggattgctc
ttctccatcagcaggggcatttacagctgcattcatggagtgcacattgaagaaaagaag
aagtctccagacttcaatctgacgggatcccagagcaacatgttaaaactcctccggtca
gccaaaaacatttccaacatgtccaacatgaactcctcaagaatggactcacccaaaaga
gctgctgacttcatccaaagaggttccctcatcatggacatggtttcagataaggggaat
ttgatgtactcagacaacaggtcctttcaggggaaagagagcatttttggagacaacatg
aacgaactccaaacatttgtggccaaccggcagaaggataacctcaataactatgtattc
cagggacaacatcctcttactctcaatgagtccaaccctaacacggtggaggtggccgtg
agcacagaatccaaagtgaactctaggccccggcagctttggaagaaatccgtggattcc
atacgccaggattcactatcccagaatccagtctcccagagggatgaggcaacagcagag
aataggacccactccctaaagagccctaggtatcttccagaagagatggcccactctgac
atttcagaaacgtcaaatcgggccacgtgccacagggaacctgacaacagtaagaaccac
aaaaccaaggacaactttaaaaggtcagtggcctccaaataccccaaggactgtagtgag
gtcgagcgcacctacctgaaaaccaaatcaagctcccctagagacaagatctacactatt
gatggtgagaaggagcctggtttccacttagatccaccccagtttgttgaaaatgtgacc
ctgcccgagaacgtggacttcccagacccctaccaggatcccagtgaaaacttgcgcaag
ggggactccacgctgccaatgaaccggaaccccttgcaaaatgaagaggggctttccaac
aacgaccagtataaactctactccaagcacttcaccttgaaagacaagggttccccgcac
agtgagaccagcgagcgataccggcagaactccacgcactgcagaagctgcctttccaac
ctgcccacctattcaggccacttcaccatgaggtcccccttcaagtgcgatgcctgcctg
cggatggggaacctctatgacatcgatgaagaccagatgcttcaggagacaggtaaccca
gccaccggggagcaggtctaccagcaggactgggcacagaacaatgcccttcaattacaa
aagaacaagctaaggattagccgtcagcattcctacgataacattgtcgacaaacctagg
gagctagaccttagcaggccctcccggagcataagcctcaaggacagggaacggcttctg
gagggaaatttttacggcagcctgtttagtgtcccctcaagcaaactctcggggaaaaaa
acctcccttttcccccaaggtctggaggacagcaagaggagcaagtctctcttgccagac
cacacctccgataaccctttcctccactcccacagggatgaccaacgcttggttattggg
agatgcccctcggacccttacaaacactcgttgccatcccaggcggtgaatgacagctat
cttcggtcgtccttgaggtcaacggcatcgtactgttccagggacagtcggggccacaat
gatgtgtatatttcggagcatgttatgccttatgctgcaaataagaataatatgtactct
acccccagggttttaaattcctgcagcaatagacgcgtgtacaagaaaatgcctagtatc
gaatctgatgtttaa

KEGG   Pan paniscus (bonobo): 100987673
Entry
100987673         CDS       T02283                                 

Gene name
GRIN1
Definition
(RefSeq) glutamate ionotropic receptor NMDA type subunit 1
  KO
K05208  glutamate receptor ionotropic, NMDA 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04724  Glutamatergic synapse
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05030  Cocaine addiction
pps05031  Amphetamine addiction
pps05033  Nicotine addiction
pps05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100987673 (GRIN1)
   04015 Rap1 signaling pathway
    100987673 (GRIN1)
   04020 Calcium signaling pathway
    100987673 (GRIN1)
   04024 cAMP signaling pathway
    100987673 (GRIN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100987673 (GRIN1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100987673 (GRIN1)
   04720 Long-term potentiation
    100987673 (GRIN1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100987673 (GRIN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100987673 (GRIN1)
   05014 Amyotrophic lateral sclerosis
    100987673 (GRIN1)
   05016 Huntington disease
    100987673 (GRIN1)
   05017 Spinocerebellar ataxia
    100987673 (GRIN1)
   05020 Prion disease
    100987673 (GRIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100987673 (GRIN1)
  09165 Substance dependence
   05030 Cocaine addiction
    100987673 (GRIN1)
   05031 Amphetamine addiction
    100987673 (GRIN1)
   05033 Nicotine addiction
    100987673 (GRIN1)
   05034 Alcoholism
    100987673 (GRIN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100987673 (GRIN1)
Ion channels [BR:pps04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100987673 (GRIN1)
SSDB
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 CaM_bdg_C0 Peripla_BP_6 Ion_trans_2
Other DBs
NCBI-GeneID: 100987673
NCBI-ProteinID: XP_003817039
Position
9
AA seq 938 aa
MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSRECAGQGCCYGFCIDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRP
EERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQA
VRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSH
ENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH
KDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
STGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgagcaccatgcgcctgctgacgctcgccctgctgttctcctgctccgtcgcccgtgcc
gcgtgcgaccccaagatcgtcaacattggcgcggtgctgagcacgcggaagcacgagcag
atgttccgcgaggccgtgaaccaggccaacaagcggcacggctcctggaagattcagctc
aatgccacctccgtcacgcacaagcccaacgccatccagatggctctgtcggtgtgcgag
gacctcatctccagccaggtctacgccatcctagttagccatccacctacccccaacgac
cacttcactcccacccctgtctcctacacagccggcttctaccgcatacccgtgctgggg
ctgaccacccgcatgtccatctactcggacaagagcatccacctgagcttcctgcgcacc
gtgccgccctactcccaccagtccagcgtgtggtttgagatgatgcgtgtctacagctgg
aaccacatcatcctgctggtcagcgacgaccacgagggccgggcggctcagaaacgcctg
gagacgctgctggaggagcgtgagtccaaggcagagaaggtgctgcagtttgacccaggg
accaagaacgtgacggccctgctgatggaggcaaaagagctggaggcccgggtcatcatc
ctttctgccagcgaggacgatgctgccactgtataccgcgcagccgcgatgctgaacatg
acgggctctgggtacgtgtggctggtcggcgagcgcgagatctcggggaacgccctgcgc
tacgccccggacggcatcctcgggctgcagctcatcaatggcaagaacgagtcggcccac
atcagcgacgccgtgggcgtggtggcccaggccgtgcacgagctcctcgagaaggagaac
atcaccgacccgccgcggggctgcgtgggcaacaccaacatctggaaaaccgggccgctc
ttcaagagagtgctgatgtcttccaagtatgcggatggggtgactggtcgcgtggagttc
aatgaggatggggaccggaagttcgccaactacagcatcatgaacctgcagaaccgcaag
ctggtgcaagtgggcatctacaatggcacccacgtcatccctaatgacaggaagatcatc
tggccaggcggagagacagagaagcctcgagggtaccagatgtccaccagactgaagatt
gtgacgatccaccaggagcccttcgtgtacgtcaagcccacgctgagtgatgggacatgc
aaggaggagttcacagtcaacggcgacccagtcaagaaggtgatctgcaccgggcccaac
gacacgtcgccgggcagccgtgagtgcgcggggcagggctgttgctacggcttttgcatc
gacctgctcatcaagctggcacggaccatgaacttcacctacgaggtgcacctggtggcg
gatggcaagttcggcacacaggagcgggtgaacaacagcaacaagaaggagtggaatggg
atgatgggcgagctgctcagcgggcaggcagacatgatcgtggcgccgctaaccataaac
aacgagcgcgcgcagtacatcgagttttccaagcccttcaagtaccagggcctgactatt
ctggtcaagaaggagattccccggagcacgctggactcgttcatgcagccgttccagagc
acactgtggctgctggtggggctgtcggtgcacgtggtggccgtgatgctgtacctgctg
gaccgcttcagccccttcggccggttcaaggtgaacagcgaggaggaggaggaggacgca
ctgaccctgtcctcggccatgtggttctcctggggcgtcctgctcaactccggcatcggg
gaaggcgcccccagaagcttctcggcgcgcatcctgggcatggtgtgggccggctttgcc
atgatcatcgtggcctcctacaccgccaacctggcggccttcctggtgctggaccggccg
gaggagcgcatcacgggcatcaacgaccctcggctgaggaacccctcggacaagtttatc
tacgccacggtgaagcagagctccgtggatatctacttccggcgccaggtggagctgagc
accatgtaccggcatatggagaagcacaactacgagagtgcggcggaggccatccaggcc
gtgagagacaacaagctgcatgccttcatctgggactcggcggtgctggagttcgaggcc
tcgcagaagtgcgacctggtgacgactggagagctgtttttccgctcgggcttcggcata
ggcatgcgcaaagacagcccctggaagcagaacgtctccctgtccatcctcaagtcccat
gagaatggcttcatggaagacctggacaagacgtgggttcggtatcaggaatgtgactcg
cgcagcaacgcccctgcgacccttacttttgagaacatggcaggggtcttcatgctggta
gctgggggcatcgtggccgggatcttcctgattttcattgagattgcctacaagcggcac
aaggatgctcgccggaagcagatgcagctggcctttgccgccgttaacgtgtggaggaag
aacctgcaggatagaaagagtggtagagcagagcctgaccctaaaaagaaagccacattt
agggctatcacctccaccctggcttccagcttcaagaggcgtaggtcctccaaagacacg
agcaccgggggtggacgcggcgctttgcaaaaccaaaaagacacagtgctgccgcgacgc
gctattgagagggaggagggccagctgcagctgtgttcccgtcatagggagagctga

KEGG   Pan paniscus (bonobo): 100987979
Entry
100987979         CDS       T02283                                 

Gene name
P2RX5
Definition
(RefSeq) purinergic receptor P2X 5
  KO
K05219  P2X purinoceptor 5
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100987979 (P2RX5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100987979 (P2RX5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100987979 (P2RX5)
Ion channels [BR:pps04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   100987979 (P2RX5)
SSDB
Motif
Pfam: P2X_receptor
Other DBs
NCBI-GeneID: 100987979
NCBI-ProteinID: XP_014197430
Position
17
AA seq 425 aa
MPTYRPPSHRWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQ
GENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHPGEAVTAGNGVKTGRCLRRE
NLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRAF
LKSCHFGPKNHYCPIFQLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHY
SFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKAGKFSIIPT
IINVGSGVALMGAGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLS
EQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRSGHLQNAQVNLEQL
QTVEM
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgcccacgtaccggcccccttcccacagatgggtgttcctgataaagaagggttaccaa
gacgtcgacacctccctgcagagtgctgtcatcaccaaagtcaagggcgtggccttcacc
aacacctcagatcttgggcagcggatctgggatgtcgctgactatgtcattccagcccag
ggagagaacgtcttttttgtggtcaccaacctgattgtgacccccaaccagcggcagaac
gtctgtgctgagaatgaaggcattcctgatggcgcgtgctccaaggacagcgactgccac
cctggggaggcggttacagctggaaacggagtgaagaccggccgctgcctgcggagagag
aacttggccaggggcacttgtgagatctttgcctggtgcccgttggagacaagctccagg
ccggaggagccattcctgaaggaggccgaagacttcaccattttcataaagaaccacatc
cgtttccccaaattcaacttctccaagagcaatgtgatggatgtcaaggacagagctttc
ctgaaatcatgccactttggccccaagaaccactactgccccatcttccaactgggctcc
gtgatccgctgggctgggagcgacttccaggatatagccctggagggtggtgtgatagga
attaatattgaatggaactgtgatcttgataaagctgcctctgagtgccaccctcactat
tcttttagccgtctggacaataaactttcaaagtctgtctcctccgggtacaacttcaga
tttgccagatattaccgagacgcagccggggtggagttccgcaccctgatgaaagcctac
gggatccgctttgacgtgatggtgaacggcaaggcagggaagttcagcatcattcccacc
atcatcaacgtgggctctggggtggcgctcatgggtgctggtgctttcttctgcgacctg
gtactcatctacctcatcaaaaagagagagttttaccgtgacaagaagtacgaagaagtg
aggggcctagaagacagttcccaggaggccgaggacgaggcatcggggctggggctatct
gagcagctcacatctgggccagggctgctggggatgccagagcagcaggagctgcaggag
ccgcctgaggcgaagcgtggaagcagcagtcagaaggggaacggatctgtgtgcccacag
ctcctggagccccacaggtctggccatttgcagaatgcacaggtgaatttggagcagctg
cagacagtggagatgtag

KEGG   Pan paniscus (bonobo): 100989438
Entry
100989438         CDS       T02283                                 

Gene name
GRIN2C
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2C
  KO
K05211  glutamate receptor ionotropic, NMDA 2C
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04724  Glutamatergic synapse
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05030  Cocaine addiction
pps05031  Amphetamine addiction
pps05033  Nicotine addiction
pps05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100989438 (GRIN2C)
   04024 cAMP signaling pathway
    100989438 (GRIN2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100989438 (GRIN2C)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100989438 (GRIN2C)
   04720 Long-term potentiation
    100989438 (GRIN2C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100989438 (GRIN2C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100989438 (GRIN2C)
   05014 Amyotrophic lateral sclerosis
    100989438 (GRIN2C)
   05017 Spinocerebellar ataxia
    100989438 (GRIN2C)
   05020 Prion disease
    100989438 (GRIN2C)
   05022 Pathways of neurodegeneration - multiple diseases
    100989438 (GRIN2C)
  09165 Substance dependence
   05030 Cocaine addiction
    100989438 (GRIN2C)
   05031 Amphetamine addiction
    100989438 (GRIN2C)
   05033 Nicotine addiction
    100989438 (GRIN2C)
   05034 Alcoholism
    100989438 (GRIN2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100989438 (GRIN2C)
Ion channels [BR:pps04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100989438 (GRIN2C)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 100989438
NCBI-ProteinID: XP_008964152
Position
17
AA seq 881 aa
MGGALGPALLLTSLFGAWAGLGLGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPL
EIQPLTVGVNNTNPSSLLTQICGLLGAARVHGIVFEDNVGTEAVAQILDFISSQTHVPIL
SISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLE
GVRAVADASHVSWRLLDVVTLELGPGGPRARTQRLLRQLDAPVFVAYCSREEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDAPPATFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HSYWRQHGTLPAPAGDCRVHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLVQPTMVV
IALNRHRLWEMVGRWEHGVLYMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRQSNHTFSSGDVAPYTKLCCKGFCIDILKKLARVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKKSGGPSFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTV
SGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKM
GSEAQPVPRKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRA
IDLALLQFLGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLV
FAWEHLVYWKLRHSVPNSTQLDFLLAFSRVGAHPSSHRPKF
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgggtggggccctggggccggccctgttgctcacctcgctcttcggtgcctgggcaggg
ctgggtctggggcagggcgagcagggcatgacggtggccgtggtgtttagcagctcaggg
ccgccccaggcccagttccgtgcccgcctcaccccccagagcttcctggacctacccctg
gagatccagccgctcacagttggggtcaacaacaccaaccccagcagcctcctcacccag
atctgcggcctcctgggtgctgcccgcgtccacggcattgtctttgaggacaacgtgggc
accgaggcggtggcccagatccttgacttcatctcctcccagacccatgtgcccatcctc
agcatcagcggaggctctgctgtggtcctcacccccaaggagccgggctccgccttcctg
cagctgggcgtgtccctggagcagcagctgcaggtgctgttcaaggtgctggaagagtac
gactggagcgccttcgccgtcatcaccagcctgcacccgggccacgcgctcttcctggag
ggcgtgcgcgccgtcgccgacgccagccacgtgagttggcggctgctggacgtggtcacg
ctggagctgggcccgggagggccgcgcgcgcgcacccagcgcctgctgcgccagctcgac
gcgcccgtgtttgtggcctactgctcgcgcgaggaggccgaggtgctcttcgccgaggcg
gcgcaggccggcctggtggggcccggccacgtgtggctggtgcccaacctggcgctgggc
agcaccgatgcgccccccgccaccttccccgtgggcctcatcagcgtcgtcaccgagagc
tggcgcctcagcctgcgccagaaggtccgcgacggcgtggccattctggccctgggcgcc
cacagctactggcgccagcatggaaccctgccagctccggccggggactgccgtgttcac
cctgggcccgtcagccctgcccgggaggccttctacaggcacctactgaatgtcacctgg
gagggccgagacttctccttcagccctggtgggtacctggtccagcccaccatggtggtg
atcgccctcaaccggcaccgcctctgggagatggtggggcgctgggagcatggcgtccta
tacatgaagtaccccgtgtggcctcgctacagtgcctctctgcagcctgtggtggacagt
cggcacctgacggtggccacgctggaagagcggccctttgtcatcgtggagagccctgac
cctggcacaggaggctgtgtccccaacaccgtgccctgccgcaggcagagcaaccacacc
ttcagcagcggggacgtggctccctacaccaagctctgctgtaagggattctgcatcgac
atcctcaagaagctggccagggtggtcaaattctcctacgacctgtacctggtgaccaac
ggcaagcatggcaagcgggtgcgcggcgtatggaacggcatgattggggaggtgtactac
aagcgggcagacatggccatcggctccctcaccatcaatgaggaacgctccgagatcgta
gacttctctgtgccctttgtggagacgggcatcagtgtgatggtggctcgcagcaatggc
accgtctccccctcggccttcttggagccatatagccctgcggtgtgggtgatgatgttt
gtcatgtgcctcactgtggtggccatcaccgtcttcatgttcgagtacttcagccccgtc
agctacaaccagaatctcaccagaggcaagaagtccgggggcccatctttcactatcggc
aagtccgtgtggctgctctgggcgctggtcttcaacaactcggtgcccatcgagaacccg
cggggcaccaccagcaagatcatggttctggtctgggccttctttgctgtcatcttcctc
gccagctacacggccaacctggccgccttcatgatccaagagcaatacatcgacactgtg
tcgggcctcagtgacaagaagtttcagcggcctcaagatcagtacccacctttccgcttc
ggcacggtgcccaacggcagcacggagcggaacatccgcagtaactaccgtgacatgcac
acccacatggtcaagttcaaccagcgctcagtggaggatgcgctcaccagcctcaagatg
ggctctgaggctcagcctgtccccaggaagctggatgccttcatctatgatgctgctgtc
ctcaactacatggcaggcaaggacgagggctgcaagctggtcaccattgggtctggcaag
gtctttgctaccactggttacggcatcgccatgcagaaggactcccactggaagcgggcc
atagacctggcgctcttgcagttcctgggggacggagagacacagaaactggagacagtg
tggctctcagggatctgccagaatgagaagaacgaggtgatgagcagcaagctggacatc
gacaacatggcaggcgtcttctacatgctgctggtggccatggggctggccctgctggtc
ttcgcctgggagcacctggtctactggaagctgcgccactcggtgcccaactcaacccag
ctggacttcctgctggctttcagcagggtgggtgcccacccctcctcacacaggccaaag
ttttaa

KEGG   Pan paniscus (bonobo): 100990374
Entry
100990374         CDS       T02283                                 

Gene name
P2RX4
Definition
(RefSeq) purinergic receptor P2X 4
  KO
K05218  P2X purinoceptor 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100990374 (P2RX4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100990374 (P2RX4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100990374 (P2RX4)
Ion channels [BR:pps04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   100990374 (P2RX4)
SSDB
Motif
Pfam: P2X_receptor DUF3624
Other DBs
NCBI-GeneID: 100990374
NCBI-ProteinID: XP_003832415
Position
12
AA seq 438 aa
MPPRGSSFPTGRWRPPPGPGPRPPVLPPSGPSSAMTAPRAGQAXXXXXXXMAGCCAALAA
FLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKG
VAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDVTTVCKSDA
SCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVK
NNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEG
GIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRT
LIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREK
KYKYVEDYEQGLASELDQ
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgccccctagaggatcatcgttcccgacggggaggtggcgccctcccccgggccccggg
ccccgaccgcccgtgctgcctccttccgggccctcctccgcgatgacggcgccgcgagca
ggccaggcgnnnnnnnnnnnnnnnnnnnncatggcgggctgctgcgccgcgctggcggcc
ttcctgttcgagtacgacacgccgcgcatcgtgctcatccgcagccgcaaagtggggctc
atgaaccgcgccgtgcaactgctcatcctggcctacgtcatcgggtgggtgtttgtgtgg
gaaaagggctaccaggaaactgactccgtggtcagctccgttacgaccaaggtcaagggc
gtggctgtgaccaacacttctaaacttggattccggatctgggatgtggcggattatgtg
ataccagctcaggaggaaaactccctcttcgtcatgaccaacgtgatcctcaccatgaac
cagacccagggcctgtgccccgagattccagatgtgaccactgtgtgtaaatcagatgcc
agctgtactgccggctctgccggcacccacagcaacggagtctcaacaggcagatgcgta
gctttcaacgggtccgtcaagacgtgtgaggtggcagcctggtgcccggtggaggatgac
acacacgtgccacaacctgcttttttaaaggctgcagaaaacttcactcttttggttaag
aacaacatctggtatcccaaatttaatttcagcaagaggaatatccttcccaacatcacc
actacttacctcaagtcgtgcatttatgatgctaaaacagatcccttctgccccatattc
cgtcttggcaaaatagtggagaacgcaggacacagtttccaggacatggccgtggaggga
ggcatcatgggcatccaggtcaactgggactgcaacctggacagagccgcctccctctgc
ttgcccaggtactccttccgccgcctcgatacacgggacgttgagcacaacgtatctcct
ggctacaatttcaggtttgccaagtactacagagacctggctggcaacgagcagcgcacg
ctcatcaaggcctatggcatccgcttcgacatcattgtgtttgggaaggcagggaaattt
gacatcatccccactatgatcaacatcggctctggcctggcgctgctaggcatggcgacc
gtgctgtgtgacatcatagtcctctactgcatgaagaaaagactctactatcgggagaag
aaatataaatatgtggaagattacgagcagggtcttgctagtgagctggaccagtga

KEGG   Pan paniscus (bonobo): 100990943
Entry
100990943         CDS       T02283                                 

Gene name
P2RX7
Definition
(RefSeq) purinergic receptor P2X 7
  KO
K05220  P2X purinoceptor 7
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100990943 (P2RX7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100990943 (P2RX7)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100990943 (P2RX7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100990943 (P2RX7)
Ion channels [BR:pps04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   100990943 (P2RX7)
SSDB
Motif
Pfam: P2X_receptor Keratin_matx Ribosomal_L5_C
Other DBs
NCBI-GeneID: 100990943
NCBI-ProteinID: XP_003832417
UniProt: A0A2R8ZH19
Position
12
AA seq 595 aa
MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISS
VHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
EYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPA
LLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGD
NFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYK
ENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVFIDFLIDTYSS
NCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRS
LQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCG
SCFPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDS
TNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgccggcctgctgcagctgcagtgatgttttccagtatgagacgaacaaagtcactcgg
atccagagcatgaattatggcaccattaagtggttcttccacgtgatcatcttttcctac
gtttgctttgctctggtgagtgacaagctgtaccagcggaaagagcctgtcatcagttct
gtgcacaccaaggtgaaggggatagcagaggtgaaagaggagatcgtggagaacggagtg
aagaagttggtgcacagtgtctttgacaccgcagactacaccttccctttgcaggggaac
tctttcttcgtgatgacaaactttctcaaaacagaaggccaagagcagcggttgtgtccc
gagtatcccacccgcaggacgctctgttcctctgaccgaggttgtaaaaagggatggatg
gacccgcagagcaaaggaattcagaccggaaggtgtgtagtgtatgaagggaaccagaag
acctgtgaagtctctgcctggtgccccatcgaggcagtggaagaggccccccggcctgct
ctcttgaacagtgccgaaaacttcactgtgctcatcaagaacaatatcgacttccccggc
cacaactacaccacgagaaacatcctgccaggtttaaacatcacttgtaccttccacaag
actcagaatccacagtgtcccattttccgactaggagacatcttccgagaaacaggcgat
aatttttcagatgtggcaattcagggcggaataatgggcattgagatctactgggactgc
aacctagaccgttggttccatcactgccgtcccaaatacagtttccgtcgccttgacgac
aagaccaccaacgtgtccttgtaccctggctacaacttcagatacgccaagtactacaag
gaaaacaatgttgagaaacggactctgataaaagtcttcgggatccgttttgacatcctg
gtttttggcaccggaggaaaatttgacattatccagctggttgtgtacatcggctcaacc
ctctcctacttcggtctggccactgtgttcatcgacttcctcatcgacacttactccagt
aactgctgtcgctcccatatttatccctggtgcaagtgctgtcagccctgtgtggtcaac
gaatactactacaggaagaagtgcgagtccattgtggagccaaagccgacattaaagtat
gtgtcctttgtggatgaatcccacattaggatggtgaaccagcagctactagggagaagt
ctgcaagatgtcaagggccaagaagtcccaagacctgcgatggacttcacagatttgtcc
aggctgcccctggccctccatgacacacccccgattcctggacaaccagaggagatacag
ctgcttagaaaggaggcgactcctagatccagggatagccccgtctggtgccaatgtgga
agctgcttcccatcccaactccctgagagccacaggtgcctggaggagctgtgctgccgg
aaaaagccgggggcctgcatcaccacctcagagctgttcaggaagctggtcctgtccaga
cacgtcctgcagttcctcctgctctaccaggagcccttgctggcgctggatgtggattcc
accaacagccggctgcggcactgtgcctacaggtgctatgccacctggcgcttcggctcc
caggacatggctgactttgccatcctgcccagctgctgccgctggaggatccggaaagag
tttcccaagagtgaagggcagtacagtggcttcaagagtccttactga

KEGG   Pan paniscus (bonobo): 100994570
Entry
100994570         CDS       T02283                                 

Gene name
P2RX1
Definition
(RefSeq) purinergic receptor P2X 1
  KO
K05215  P2X purinoceptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100994570 (P2RX1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100994570 (P2RX1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100994570 (P2RX1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100994570 (P2RX1)
Ion channels [BR:pps04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   100994570 (P2RX1)
SSDB
Motif
Pfam: P2X_receptor
Other DBs
NCBI-GeneID: 100994570
NCBI-ProteinID: XP_003810270
UniProt: A0A2R9AHU8
Position
17
AA seq 399 aa
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSG
LISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEH
PEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLR
EAENFTLFIKNSISFPRFKVNRRNLVEEVNAAYMKTCLFHKTLHPLCPVFQLGYVVQESG
QNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVEN
GTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKR
HYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcacggcggttccaggaggagctggccgccttcctcttcgagtatgacaccccccgc
atggtgctggtgcgtaacaagaaggtgggcgttatcttccgactgatccagctggtggtc
ctggtctacgtcatcgggtgggtgtttctctacgagaagggctaccagacctcgagcggc
ctcatcagcagtgtctctgtgaaactcaagggcctggccgtgacccagctccctggcctc
ggcccccaggtctgggacgtggctgactacgtcttcccagcccagggggacaactccttc
gtggtcatgaccaatttcatcgtgaccccaaagcagactcaaggctactgcgcagagcac
ccagaagggggcatatgcaaggaagacagtggctgtacccctgggaaggccaagaggaag
gcccaaggcatccgcacgggcaagtgtgtggccttcaacgacactgtgaagacctgtgag
atctttggctggtgccccgtggaggtggatgacgacatcccgcgccctgcccttctccga
gaggccgagaacttcactcttttcatcaagaacagcatcagctttccacgcttcaaggtc
aacaggcgcaacctggtggaggaggtgaatgctgcctacatgaagacctgcctctttcac
aagaccctgcaccccctgtgcccagtcttccagcttggctacgtggtgcaagagtcaggc
cagaacttcagcaccctggctgagaagggtggagtggttggcatcaccatcgactggcac
tgtgacctggactggcatgtacggcactgcagacccatctatgagttccatgggctgtac
gaagagaaaaatctctccccaggcttcaacttcaggtttgccaggcactttgtggagaac
gggaccaactaccgtcacctcttcaaggtgtttgggattcgctttgacatcctggtggac
ggcaaggccgggaagtttgacatcatccctacaatgaccaccatcggctctggaattggc
atctttggggtggccacagttctctgtgacctgctgctgcttcacatcctgcctaagagg
cactactacaagcagaagaagttcaagtacgctgaggacatggggccaggggcggctgag
cgtgacctcgcagctaccagctccaccctgggcctgcaggagaacatgaggacatcctga

DBGET integrated database retrieval system