KEGG   Pan paniscus (bonobo): 100970528
Entry
100970528         CDS       T02283                                 

Gene name
PPIF
Definition
(RefSeq) peptidylprolyl isomerase F
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04613  Neutrophil extracellular trap formation
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05145  Toxoplasmosis
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100970528 (PPIF)
   04022 cGMP-PKG signaling pathway
    100970528 (PPIF)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100970528 (PPIF)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100970528 (PPIF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100970528 (PPIF)
   05012 Parkinson disease
    100970528 (PPIF)
   05016 Huntington disease
    100970528 (PPIF)
   05017 Spinocerebellar ataxia
    100970528 (PPIF)
   05020 Prion disease
    100970528 (PPIF)
   05022 Pathways of neurodegeneration - multiple diseases
    100970528 (PPIF)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100970528 (PPIF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pps03110]
    100970528 (PPIF)
Enzymes [BR:pps01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100970528 (PPIF)
Chaperones and folding catalysts [BR:pps03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    100970528 (PPIF)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 100970528
NCBI-ProteinID: XP_003813070
UniProt: A0A2R9ARV0
Position
10
AA seq 207 aa
MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGAGDPSSSSSSGNPLVYLDVDANGKPLG
RVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSI
YGSRFPDENFILKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDV
VKKIESFGSKSGRTSKKIVITDCGQLS
NT seq 624 nt   +upstreamnt  +downstreamnt
atgctggcgctgcgctgcggttcccgctggctcggcctgctctccgtcccgcgctccgtg
ccgctgcgcctccccgcggcccgcgcctgcagcaagggcgccggcgacccgtcctcttcc
tcctcctccgggaacccgctcgtgtacctggacgtggacgccaacgggaagccgctcggc
cgcgtggtgctggagctgaaggcagatgtcgtcccaaagacagctgagaacttcagagcc
ctgtgcactggtgagaagggcttcggctacaaaggctccaccttccacagggtgatccct
tccttcatgtgccaggcgggcgacttcaccaaccacaacggcacaggcgggaagtccatc
tacggaagccgctttcctgacgagaactttatactgaagcacgtggggccaggtgtcctg
tccatggctaatgctggtcctaacaccaacggctcccagttcttcatctgcaccataaag
acagactggttggatggcaagcatgttgtgttcggtcacgtcaaagagggcatggacgtc
gtgaagaaaatagaatctttcggctctaagagtgggaggacatccaagaagattgtcatc
acagactgtggccagttgagctaa

DBGET integrated database retrieval system