KEGG   Pan paniscus (bonobo): 100971042
Entry
100971042         CDS       T02283                                 

Gene name
SLC25A4
Definition
(RefSeq) solute carrier family 25 member 4
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04217  Necroptosis
pps04218  Cellular senescence
pps04613  Neutrophil extracellular trap formation
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100971042 (SLC25A4)
   04022 cGMP-PKG signaling pathway
    100971042 (SLC25A4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100971042 (SLC25A4)
   04218 Cellular senescence
    100971042 (SLC25A4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100971042 (SLC25A4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100971042 (SLC25A4)
   05164 Influenza A
    100971042 (SLC25A4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100971042 (SLC25A4)
   05012 Parkinson disease
    100971042 (SLC25A4)
   05016 Huntington disease
    100971042 (SLC25A4)
   05017 Spinocerebellar ataxia
    100971042 (SLC25A4)
   05020 Prion disease
    100971042 (SLC25A4)
   05022 Pathways of neurodegeneration - multiple diseases
    100971042 (SLC25A4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100971042 (SLC25A4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pps03029]
    100971042 (SLC25A4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100971042 (SLC25A4)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100971042 (SLC25A4)
Transporters [BR:pps02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100971042 (SLC25A4)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 100971042
NCBI-ProteinID: XP_008975376
Position
4
AA seq 301 aa
FPHPFFLQKKKSRKCKPFFSCPLPFSLPCLSSVTHPPLHQVQHASKQISAEKQYKGIIDC
VVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNL
ASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGF
NVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRR
MMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY
V
NT seq 906 nt   +upstreamnt  +downstreamnt
tttcctcatcctttttttcttcaaaaaaaaaaatctaggaagtgcaaaccttttttctcc
tgtcctcttcccttctctctgccctgcctgtcctctgtcacccaccctcccctccaccag
gtccagcatgccagcaaacagatcagtgctgagaagcagtacaaagggatcattgattgt
gtggtgagaatccctaaggagcagggcttcctctccttctggaggggtaacctggccaac
gtgatccgttacttccccacccaagctctcaacttcgccttcaaggacaagtacaagcag
ctcttcttagggggtgtggatcggcataagcagttctggcgctactttgctggtaacctg
gcgtccggtggggccgctggggccacctccctttgctttgtctacccgctggactttgct
aggaccaggttggctgctgacgtgggcaagggcgccgcccagcgtgagttccatggtctg
ggcgactgtatcatcaagatcttcaagtctgatggcctgagggggctctaccagggtttc
aacgtctctgtccaaggcatcattatctatagagctgcctacttcggagtctatgatact
gccaaggggatgctgcctgaccccaagaatgtgcacatttttgtgagctggatgattgcc
cagagtgtgacggcagtcgcagggctggtgtcctacccctttgacactgttcgtcgtaga
atgatgatgcagtccggccggaagggggccgatattatgtacacggggacagttgactgc
tggaggaagattgcaaaagacgaaggagccaaggccttcttcaaaggtgcctggtccaat
gtgctgagaggcatgggcggtgcttttgtattggtgttgtatgatgagatcaaaaaatat
gtctaa

KEGG   Pan paniscus (bonobo): 100981051
Entry
100981051         CDS       T02283                                 

Definition
(RefSeq) ADP/ATP translocase 3-like
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04217  Necroptosis
pps04218  Cellular senescence
pps04613  Neutrophil extracellular trap formation
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100981051
   04022 cGMP-PKG signaling pathway
    100981051
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100981051
   04218 Cellular senescence
    100981051
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100981051
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100981051
   05164 Influenza A
    100981051
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100981051
   05012 Parkinson disease
    100981051
   05016 Huntington disease
    100981051
   05017 Spinocerebellar ataxia
    100981051
   05020 Prion disease
    100981051
   05022 Pathways of neurodegeneration - multiple diseases
    100981051
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100981051
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pps03029]
    100981051
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100981051
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100981051
Transporters [BR:pps02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100981051
SSDB
Motif
Pfam: Mito_carr Fuseless
Other DBs
NCBI-GeneID: 100981051
NCBI-ProteinID: XP_008953747
Position
9
AA seq 293 aa
MTEQAISFAKDFLAGGITAAISKTAVASIKRVQLLLQMQHASMPMAAAKQCKGIVDCIVR
IPKDQGVLSFWRGNLANVIRYSPTQAHNFAFKDKYKQIFLAGVDKHTQFCRCFAGNLASG
GTAVVYPLDFTRTRLAADVGKSGTEREFRGQGDCLVKISKSDGIRGFYQGFSVSVQAIII
YQAAYFRVYDTAKGMFPDPKNTHILVSWMIAQTVTAVAGVVSYPFDTVRRRTMMQSRRKG
ADSMYTGTVDCWRKIFRDERGEAFFKGVWSNALRGMGVGAGFVLVPYDELKVS
NT seq 882 nt   +upstreamnt  +downstreamnt
atgacggaacaagccatctccttcgccaaggacttcctagccggaggcatcaccgccgct
atctccaagacagccgtggcatcgatcaagcgggtccagctgctgctgcagatgcagcac
gccagcatgccgatggccgccgccaagcagtgcaagggcatcgtggactgcatcgtccgc
atccccaaagatcagggcgtgctgtccttctggaggggcaacctggccaatgtcatccgc
tactcccccacgcaagcccacaatttcgccttcaaggataagtacaagcagatcttcctg
gcgggcgtggacaagcacacgcagttctgcaggtgctttgcgggcaacctggcctctggc
ggcacggccgtcgtgtatcccctggatttcaccagaacccgcctggcagctgacgtggga
aagtcaggcacggagcgcgagttccgaggccagggagactgcctagtgaagatcagcaag
tccgacggcatccggggcttttaccagggcttcagcgtctccgtgcaggccatcatcatc
taccaggcagcctacttcagggtgtacgatacggccaagggcatgttccccgaccctaag
aacacacacatcctggtgagctggatgatcgcgcagaccgtgacggccgtggctggcgtg
gtctcctacccctttgacacagtgcggcggcggacgatgatgcagtcccggcgcaaagga
gctgacagcatgtacacgggcaccgtcgactgttggagaaagatcttcagagacgagcgg
ggcgaggcctttttcaagggtgtgtggtccaacgccctcagaggcatgggggtgggggcg
ggcttcgtgctggtcccgtacgacgagctgaaggtcagctaa

KEGG   Pan paniscus (bonobo): 100984012
Entry
100984012         CDS       T02283                                 

Gene name
SLC25A31
Definition
(RefSeq) solute carrier family 25 member 31
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04217  Necroptosis
pps04218  Cellular senescence
pps04613  Neutrophil extracellular trap formation
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100984012 (SLC25A31)
   04022 cGMP-PKG signaling pathway
    100984012 (SLC25A31)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100984012 (SLC25A31)
   04218 Cellular senescence
    100984012 (SLC25A31)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100984012 (SLC25A31)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100984012 (SLC25A31)
   05164 Influenza A
    100984012 (SLC25A31)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100984012 (SLC25A31)
   05012 Parkinson disease
    100984012 (SLC25A31)
   05016 Huntington disease
    100984012 (SLC25A31)
   05017 Spinocerebellar ataxia
    100984012 (SLC25A31)
   05020 Prion disease
    100984012 (SLC25A31)
   05022 Pathways of neurodegeneration - multiple diseases
    100984012 (SLC25A31)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100984012 (SLC25A31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pps03029]
    100984012 (SLC25A31)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100984012 (SLC25A31)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100984012 (SLC25A31)
Transporters [BR:pps02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100984012 (SLC25A31)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 100984012
NCBI-ProteinID: XP_003823148
UniProt: A0A2R9A6Y1
Position
4
AA seq 315 aa
MHREPAKKKAEKRLFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPE
ARYKGMVDCLVRIPREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQ
FWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSD
GIAGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKKTPFLVSFFIAQVVTTCSGILS
YPFDTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGISSFFHGAFSNVLRGTGGALVLVL
YDKIKEFFHIDIGGR
NT seq 948 nt   +upstreamnt  +downstreamnt
atgcatcgtgagcctgcaaaaaagaaggcagaaaagcggctgtttgacgcgtcgtccttc
gggaaggaccttctggccggcggagtcgcggcagctgtgtccaagacagcggtggcgccc
atcgagcgggtgaagctgctgctgcaggtgcaggcgtcgtcgaagcagatcagccccgag
gcgcggtacaaaggcatggtggactgcctggtgcggattcctcgcgagcagggtttcttc
agtttttggcgtggcaatttggcaaatgttattcggtattttccaacacaagctctaaac
tttgcttttaaggacaaatacaagcagctattcatgtctggagttaataaagaaaaacag
ttctggaggtggtttttggcaaacctggcttctggtggagctgctggggcaacatcctta
tgtgtagtatatcctctagattttgcccgaacccgattaggtgtcgatattggaaaaggt
cctgaggagcgacaattcaagggtttaggtgactgtattatgaaaatagcaaaatcagat
ggaattgctggtttataccaagggtttggtgtttcagtacagggcatcattgtgtaccga
gcctcttattttggagcttatgacacagttaagggtttattaccaaagccaaagaaaact
ccatttcttgtctcctttttcattgctcaagttgtgactacatgctctggaatactttct
tatccctttgacacagttagaagacgtatgatgatgcagagtggtgaggctaaacggcaa
tataaaggaaccttagactgctttgtgaagatataccaacatgaaggaatcagttccttt
tttcatggcgccttctccaatgttcttcgcggtacagggggtgctttggtgttggtatta
tatgataaaattaaagaattctttcatattgatattggtggtaggtaa

KEGG   Pan paniscus (bonobo): 100991246
Entry
100991246         CDS       T02283                                 

Gene name
SLC25A5
Definition
(RefSeq) solute carrier family 25 member 5
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04217  Necroptosis
pps04218  Cellular senescence
pps04613  Neutrophil extracellular trap formation
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100991246 (SLC25A5)
   04022 cGMP-PKG signaling pathway
    100991246 (SLC25A5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100991246 (SLC25A5)
   04218 Cellular senescence
    100991246 (SLC25A5)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100991246 (SLC25A5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100991246 (SLC25A5)
   05164 Influenza A
    100991246 (SLC25A5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100991246 (SLC25A5)
   05012 Parkinson disease
    100991246 (SLC25A5)
   05016 Huntington disease
    100991246 (SLC25A5)
   05017 Spinocerebellar ataxia
    100991246 (SLC25A5)
   05020 Prion disease
    100991246 (SLC25A5)
   05022 Pathways of neurodegeneration - multiple diseases
    100991246 (SLC25A5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100991246 (SLC25A5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pps03029]
    100991246 (SLC25A5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100991246 (SLC25A5)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100991246 (SLC25A5)
Transporters [BR:pps02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100991246 (SLC25A5)
SSDB
Motif
Pfam: Mito_carr Fuseless
Other DBs
NCBI-GeneID: 100991246
NCBI-ProteinID: XP_003812675
UniProt: A0A2R9BII9
Position
X
AA seq 298 aa
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT
NT seq 897 nt   +upstreamnt  +downstreamnt
atgacagatgccgctgtgtccttcgccaaggacttcctggcaggtggagtggccgcagcc
atctccaagacggcggtagcgcccatcgagcgggtcaagctgctgctgcaggtgcagcat
gccagcaagcagatcactgcagataagcaatacaaaggcattatagactgcgtggtccgt
attcccaaggagcagggagttctgtccttctggcgcggtaacctggccaatgtcatcaga
tacttccccacccaggctcttaacttcgccttcaaagataaatacaagcagatcttcctg
ggtggtgtggacaagagaacccagttttggcgctactttgcagggaatctggcatcgggt
ggtgccgcaggggccacatccctgtgttttgtgtaccctcttgattttgcccgtacccgt
ctagcagctgatgtgggtaaagctggagctgaaagggaattccgaggcctcggtgactgc
ctggttaagatctacaaatctgatgggattaagggcctgtaccaaggctttaacgtgtct
gtgcagggtattatcatctaccgagccgcctacttcggtatctatgacactgcaaaggga
atgcttccggatcccaagaacactcacatcgttatcagctggatgatcgcacagactgtc
actgctgttgccgggttgacttcctatccatttgacaccgttcgccgccgcatgatgatg
cagtcagggcgcaaaggaactgacatcatgtacacaggcacgcttgactgctggaggaag
attgctcgtgatgaaggaggcaaagcttttttcaagggtgcatggtccaatgttctcaga
ggcatgggtggtgcttttgtgcttgtcttgtatgatgaaatcaagaagtacacataa

DBGET integrated database retrieval system