KEGG   Pan paniscus (bonobo): 100971084
Entry
100971084         CDS       T02283                                 

Gene name
TPCN2
Definition
(RefSeq) two pore segment channel 2
  KO
K14077  two pore calcium channel protein 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100971084 (TPCN2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100971084 (TPCN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100971084 (TPCN2)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Calcium channel, two-pore (TPC)
   100971084 (TPCN2)
SSDB
Motif
Pfam: Ion_trans
Other DBs
NCBI-GeneID: 100971084
NCBI-ProteinID: XP_003828809
UniProt: A0A2R9AGL4
Position
11
AA seq 752 aa
MAEPQAESEPLLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYR
SINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEP
PCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLMC
HEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAG
GKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGS
LFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQ
NLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSP
FLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYY
LLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMLGLLSL
WDMTRMLNMLIVFRFLRIIPSMKPMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINL
FRGVIVASPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLD
AYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQM
TVELLFRDILEEPGEDELTERLSQHPHLWLCR
NT seq 2259 nt   +upstreamnt  +downstreamnt
atggcggaaccccaggcggagtcggagcccctgctgggcggggcccgcggcggtggcggc
gactggccggcggggctgaccacttaccgcagcatccaagtcggccctggtgctgcggcc
aggtgggacctctgcattgatcaggctgtggtcttcatcgaagatgctattcagtaccgc
tccatcaaccaccgggtggatgccagctcgatgtggctttaccgacggtattactcgaac
gtatgccaacggactttgagcttcaccatcttcttgatcctgtttttggcttttatcgag
accccatcctcactcaccagcacggcggacgtgcgctaccgcgctgccccctgggagccg
ccctgcggcctgaccgagagtgtcgaggtgctctgcctgctggtctttgcggccgacctc
tctgtgaagggttacctgttcgggtgggcccatttccagaaaaacctttggctgctgggc
tacctcgtggtgctggtggtgtctctggtggactggaccgtgtccctgagtctcatgtgt
catgagcccctgcggatccgccggcttctccgtcccttcttcctgctgcagaactcctct
atgatgaagaagaccttgaaatgcatccgctggtcgctgccggaaatggccagcgtcggg
ctgctgctggccatccacctgtgcctcttcaccatgttcggaatgctgctgttcgccggt
gggaagcaggatgatgggcaggacagggagaggctgacctacttccagaacctgcctgag
tctctgacttccctcctggtgctgctgaccacggccaacaaccccgatgtgatgattcct
gcgtattccaagaaccgggcctatgccatcttcttcatagtcttcactgtgataggaagc
ctgtttctgatgaacctgctgacagccatcatctacagtcagttccggggctacctgatg
aaatctctccagacctcgctgtttcggaggcggctgggaacccgggctgcctttgaagtc
ctatcctccatggtgggggagggaggagccttccctcaggcagttggggtgaagccccag
aacttgctgcaggtgcttcagaaggtccagctggacagctcccacaaacaggccatgatg
gagaaggtgcgttcctacggcagtgttctgctctcagctgaggagtttcagaagctcttc
aacgagcttgacagaagtgtggttaaagagcacccgccgaggcccgagtaccagtctccg
tttctgcagagcgcccagttcctctttggccactactactttgactacctggggaacctc
atcgccctggcaaacctggtgtccatttgcgtgttcctggtgctggatgcagatgtgctg
cctgctgagcgtgatgacttcatcctggggattctcaactgcgtcttcattgtgtactac
ctgttggagatgctgctcaaggtctttgccctgggcctgcgagggtacctgtcctacccc
agcaacgtgtttgacgggctcctcaccgttgtcctgctggttttggagatctcaactctg
gctgtgtaccgattgccacacccaggctggaggccggagatgctgggcctgctgtcgctg
tgggacatgacccgcatgctgaacatgctcatcgtgttccgcttcctgcgtatcatcccc
agcatgaagccgatggccgtggtggccagtaccgtcctgggcctggtgcagaacatgcgt
gcgtttggcgggatcctggtggtggtctactacgtatttgccatcattgggatcaacttg
tttagaggcgtcattgtggcttctcctggaaacagcagcctggcccctgccaatggctcg
gcgccctgtgggagcttcgagcagctggagtactgggccaacaacttcgatgactttgcg
gctgccctcgtcactctgtggaacttgatggtggtgaacaactggcaggtgtttctggat
gcgtatcggcgctactcgggcccgtggtccaagatctattttgtattgtggtggctggtg
tcgtctgtcatctgggtcaacctgtttctggccctgattctggagaacttccttcacaag
tgggacccccgcagccacctgcagccccttgctgggaccccagaggccacctaccagatg
actgtggagctcctgttcagggatattctggaggagcccggggaggatgagctcacagag
aggctgagccagcacccgcacctgtggctgtgcaggtga

KEGG   Pan paniscus (bonobo): 100990039
Entry
100990039         CDS       T02283                                 

Gene name
TPCN1
Definition
(RefSeq) two pore segment channel 1
  KO
K16896  two pore calcium channel protein 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100990039 (TPCN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100990039 (TPCN1)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Calcium channel, two-pore (TPC)
   100990039 (TPCN1)
SSDB
Motif
Pfam: Ion_trans Pilin_N YkuD
Other DBs
NCBI-GeneID: 100990039
NCBI-ProteinID: XP_008956077
UniProt: A0A2R9B788
Position
12
AA seq 888 aa
MESCYIAQAGLELLGSSSSPTLTSQSAEITEDASNGGVSEQHPWPSGFERELKPETISSP
GYHILRATGEENMAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQ
APSLSSGGESSPSSPVHNWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLF
YLMELATALLLLLLSLCEAPAVPALRLGIYVHATLELFALMVVVFELCMKLRWLGLHTFI
RHKRTMVKTSVLVVQFVEAIVVLVRQMSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQS
LPPFMDILLLLLFFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLLTTANFPDVMMP
SYSRNPWSCVFFIVYLSIELYFIMNLLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAYRL
LISQRRPAGISYRQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAAL
KWKAKKNREHWFDELPRTALLIFKGINILVKSKAFQYFMYLVVAVNGVWILVETFMLKGG
NFFSKHVPWSYLVFLTIYGVELFLKVAGLGPVEYLSSGWNLFDFSVTVFAFLGLLALALN
MEPFYFIVVLRPLQLLRLFKLKERYRNVLDTMFELLPRMASLGLTLLIFYYSFAIVGMEF
FCGIVFPNCCNTSTVADAYRWRNHTVGNRTVVEEGYYYLNNFDNILNSFVTLFELTVVNN
WYIIMEGVTSQTSHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKNQDSEVDGG
ITLEKEISKEELVAVLELYREARGASSDVTRLLETLSQMERYQQHSMVFLGRRSRTKSDL
SLKMYQEEIQEWYEEHAREQKQQRQLSSSAAPAAQQPPGSRQRSQTVT
NT seq 2667 nt   +upstreamnt  +downstreamnt
atggagtcttgctacattgcccaggctggtcttgaactgctaggctcaagcagttctccc
accttgacctcccaaagcgctgagattacagaagatgcctctaatggaggagtttctgag
cagcacccctggcccagtggctttgaaagggagctcaaaccagagactatttcaagccct
ggatatcatatcctgagggccacaggagaagagaacatggctgtgagtttggatgacgac
gtgccgctcatcctgaccttggatgagggtggcagtgccccactggctccctccaacggc
ctgggccaagaagagctacctagcaaaaatggcggcagctatgccatccacgactcccag
gcccccagtctcagctctgggggtgagagttccccctccagccccgtacacaactgggag
atgaattaccaagaggcagcaatctacctccaggaaggcgagaacaacgacaagttcttc
acccaccccaaggatgccaaggcgctggcggcctacctctttgcacacaatcacctcttc
tacctgatggagctggccacggccctgctgctgctgctgctctccctgtgcgaggccccc
gccgtccccgcactccggcttggcatctatgtccacgccaccctggagctgttcgccctg
atggtggtagtgtttgaactctgcatgaagttacgctggctgggcctccacaccttcatc
cggcacaagcggaccatggtcaagacctcggtgctggtggtgcagtttgtcgaggccatc
gtggtgttggtacggcagatgtcccatgtgcgggtgacccgagcactgcgctgcattttc
ctggtggactgtcggtattgcggtggcgtccggcgcaacctgcggcagatcttccagtcc
ctgccccccttcatggacatcctcctgctgctgctgttcttcatgatcatctttgccatc
ctcggtttctacttgttctcccctaacccttcagacccctacttcagcaccctggagaac
agcatcgttagtctgtttgtccttctgaccacagccaatttcccagatgtgatgatgccc
tcctactcccggaacccctggtcctgcgtcttctttatcgtgtacctctccatcgagctg
tatttcatcatgaacctgcttctggctgtggtgttcgacaccttcaacgacattgagaaa
cgcaagttcaagtctttgctactgcacaagcgaaccgctatccagcatgcctaccgtctg
ctcatcagccagaggaggcctgccggcatctcctacaggcagtttgaaggcctcatgcgc
ttctacaagccccggatgagtgccagggagcgctatcttaccttcaaggccctgaatcag
aacaacacacccctgctcagcctaaaggacttttacgatatctacgaagttgctgctttg
aagtggaaggccaagaaaaacagagagcactggtttgatgagcttcccaggacagcgctc
ctcatcttcaaaggtattaatatccttgtgaagtccaaggccttccagtatttcatgtac
ttggtggtggcagtcaacggggtctggatcctcgtggagacatttatgctgaaaggtggg
aacttcttctccaagcacgtgccctggagttacctcgtctttctaactatctatggggtg
gagctgttcctgaaggtcgccggcctgggccctgtggagtacttgtcttccggatggaac
ttgttcgacttctccgtgacagtgttcgccttcctgggactgctggcgctggccctcaac
atggagcccttctatttcatcgtggtcctgcgccccctccagctgctgaggttgtttaag
ttgaaggagcgctaccgcaacgtgctggacaccatgttcgagctgctgccccggatggcc
agcctgggtctcaccctgctcatcttttattactccttcgccatcgtgggcatggagttc
ttctgcgggatcgtcttccccaactgctgcaacacgagtacagtggcagatgcctaccgc
tggcgcaaccacaccgtgggcaacaggaccgtggtggaggaaggctactattatctcaat
aattttgacaacatcctcaacagctttgtgaccctgtttgagctcacagttgtcaacaac
tggtacatcatcatggaaggcgtcacctctcagacctcccactggagccgcctctacttc
atgaccttttacattgtgaccatggtggtgatgacgatcattgtcgcctttatcctcgag
gccttcgtcttccgaatgaactacagccgcaagaaccaggactcggaagttgatggtggc
atcacccttgagaaggaaatctccaaagaagagctggttgccgtcctggagctctaccgg
gaggcacggggggcctcctcggatgtcacccggctgctggagaccctctcccagatggag
agataccagcaacattccatggtgtttctgggacggcgatcaaggaccaagagcgacctg
agcctgaagatgtaccaggaggagatccaggagtggtatgaggagcatgccagggagcag
aagcagcagcgacagctcagcagcagtgcagcccccgccgcccagcagcccccaggcagc
cgccagcgctcccagactgttacctag

DBGET integrated database retrieval system