KEGG   Pan paniscus (bonobo): 100971898
Entry
100971898         CDS       T02283                                 

Gene name
CACNA1A
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 A
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04020  Calcium signaling pathway
pps04721  Synaptic vesicle cycle
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04727  GABAergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04742  Taste transduction
pps04930  Type II diabetes mellitus
pps05017  Spinocerebellar ataxia
pps05032  Morphine addiction
pps05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100971898 (CACNA1A)
   04020 Calcium signaling pathway
    100971898 (CACNA1A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100971898 (CACNA1A)
   04727 GABAergic synapse
    100971898 (CACNA1A)
   04725 Cholinergic synapse
    100971898 (CACNA1A)
   04728 Dopaminergic synapse
    100971898 (CACNA1A)
   04726 Serotonergic synapse
    100971898 (CACNA1A)
   04730 Long-term depression
    100971898 (CACNA1A)
   04723 Retrograde endocannabinoid signaling
    100971898 (CACNA1A)
   04721 Synaptic vesicle cycle
    100971898 (CACNA1A)
  09157 Sensory system
   04742 Taste transduction
    100971898 (CACNA1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100971898 (CACNA1A)
  09165 Substance dependence
   05032 Morphine addiction
    100971898 (CACNA1A)
   05033 Nicotine addiction
    100971898 (CACNA1A)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100971898 (CACNA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100971898 (CACNA1A)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100971898 (CACNA1A)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DUF2207
Other DBs
NCBI-GeneID: 100971898
NCBI-ProteinID: XP_014198004
Position
19
AA seq 2286 aa
MARFGDEMPARYGGGGSGAAAGVVVGAGGGRGARGSRQGGQPGAQRMYKQSMAQRARTMA
LYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALEQH
LPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTG
ILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAILIF
AIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQ
FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS
GEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDDTDGEQRHPFDAL
RRTTIKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRFYIR
RMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYGL
GTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWASLR
NLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMTV
FQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQ
ELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQRTSE
MRKQNLLASREALYNEMDPDERWKAAYTRHLRPDMKTHLDRPLVVDPQENRNNNTNKSRA
AEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGVHSPLQKDAQVISWHKNAMHSRCY
ATGHLFQAEDARSPGRRGENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNK
LATAESAAPHGSLGHAGLPQSPAKMGNSTDPGPTPAIPAMATNLNKNANPDPLPKKEEEK
KEEEEDDRGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIALA
AEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVS
GALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILI
VYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYEFH
YDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFF
VNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMWQF
VVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLFSLECVLKVMAFGI
LNYFRDAWNIFDFVTVLGSITDILVTEFGNPNNFINLSFLRLFRAARLIKLLRQGYTIRI
LLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSDEDEFQITEHNNFR
TFFQALMLLFRGAPSPFFSVSITSPFPSLFLSLSHFLSPSSLYPSLHLGVCVHVFGSVCL
SVCILLTHSFIPSVSAPTLSWSPGSPQMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVR
VWAEYDPAAWGRMPYLDMYQMLRHMSPPLGLGKKCPARVAYKRLLRMDLPVADDNTVHFN
STLMALIRTALDIKIAKGGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVG
KIYAAMMIMEYYRQSKAKKLQAMREEQDRTPLMFQRMEPPSPTQEGGPGQNALPSTQLDP
GGALMAHESGLKESPSWVTQRAQEMFQKTGTWSPEQGPPTDMPNSQPNSQSVEMREMGRD
GYSDSEHYLPMEGQGRAASMPRLPAENQRRRGRPRGNNLSTISDTSPMKRSASVLGPKAR
RLDDYSLERVPPEENQRHHQRRRDRSHRASERSLGRYTDVDTGLGTDLSMTTQSGDLPSK
ERDQERGRPKDRKHRQHHHHHHHHHPPPPDKDRYAQERPDHGRARARDQRWSRSPSEGRE
HMAHRQVGAAASDPRLGSAGRRGGEKGIPHPTATLGKGPRIPAVTTSHPAPKPPGCPAAG
ADTDPHHTSCLCCPPSPLAHPPPPPRRPQLLPPRLWIIFEFWAGGGEEAMARAYDAPPPV
RHASSGATGRSPRTPRASGPACASPSRHGRRLPNGYYPAHGLARPRGPGSRKGLHEPYSE
SDDDWC
NT seq 6861 nt   +upstreamnt  +downstreamnt
atggcccgcttcggagacgagatgccggcccgctacgggggaggaggctccggggcagcc
gccggggtggtcgtgggcgccggaggcgggcgaggagcccggggcagccggcagggcggg
cagcccggggcgcaaaggatgtacaagcagtcaatggcgcagagagcgcggaccatggca
ctctacaaccccatccccgtccgacagaactgcctcacggttaaccggtctctcttcctc
ttcagcgaagacaacgtggtgagaaaatacgccaaaaagatcaccgaatggcctcccttt
gaatatatgattttagccaccatcatagcgaattgcatcgtcctcgcactggagcagcat
ctgcctgatgatgacaagaccccgatgtctgaacggctggatgacacagaaccatacttc
attggaattttttgtttcgaggctggaattaaaatcattgcccttgggtttgccttccac
aaaggctcctacttgaggaatggctggaatgtcatggactttgtggtggtgctaacgggc
atcttggcgacagttgggacggagtttgacctacggacgctgagggcagttcgagtgctg
cggccgctcaagctggtgtctggaatcccaagtttacaagtcgtcctgaagtcgatcatg
aaggcgatgatccctttgctgcagatcggcctcctcctattttttgcaatccttattttt
gcaatcatagggttagaattttatatgggaaaatttcataccacctgctttgaagagggg
acagatgacattcagggtgagtctccggctccatgtgggacagaagagcccgcccgcacc
tgccccaatgggaccaaatgtcagccctactgggaagggcccaacaacgggatcactcag
ttcgacaacatcctgtttgcagtgctgactgttttccagtgcataaccatggaagggtgg
actgatctcctctacaatagcaacgatgcctcagggaacacttggaactggttgtacttc
atccccctcatcatcatcggctccttttttatgctgaaccttgtgctgggtgtgctgtca
ggggagtttgccaaagaaagggaacgggtggagaaccggcgggcttttctgaagctgagg
cggcaacaacagattgaacgtgagctcaatgggtacatggagtggatctcaaaagcagaa
gaggtgatcctcgccgaggatgacactgacggggagcagaggcatccctttgatgctctg
cggagaaccaccataaagaaaagcaagacagatttgctcaaccccgaagaggctgaggat
cagctggctgatatagcctctgtgggttctcccttcgcccgagccagcattaaaagtgcc
aagctggagaactcgaccttttttcacaaaaaggagaggaggatgcgtttctacatccgc
cgcatggtcaaaactcaggccttctactggactgtactcagtttggtagctctcaacacg
ctgtgtgttgctattgttcactacaaccagcccgagtggctctccgacttcctttactat
gcagaattcattttcttaggactctttatgtccgaaatgtttataaaaatgtacgggctt
gggacgcggccttacttccactcttccttcaactgctttgactgtggggttatcattggg
agcatcttcgaggtcatctgggctgtcataaaacctggcacatcctttggaatcagcgtg
ttacgagccctcaggttattgcgtattttcaaagtcacaaagtactgggcatctctcaga
aacctggtcgtctctctcctcaactccatgaagtccatcatcagcctgttgtttctcctt
ttcctgttcattgtcgtcttcgcccttttgggaatgcaactcttcggcggccagtttaat
ttcgatgaagggactcctcccaccaacttcgatacttttccagcagcaataatgacggtg
tttcagatcctgacgggcgaagactggaacgaggtcatgtacgacgggatcaagtctcag
gggggcgtgcagggcggcatggtgttctccatctatttcattgtactgacactgtttggg
aactacaccctcctgaatgtgttcttggccatcgctgtggacaatctggccaacgcccag
gagctcaccaaggacgagcaagaggaagaagaagcagccaaccagaaacttgccctacag
aaagccaaggaggtggcagaagtgagtcctctgtccgcggccaacatgtctatagctgtg
aaagagcaacagaagaatcaaaagccagccaagtccgtgtgggagcagcggaccagtgag
atgcgaaagcagaacttgctggccagccgggaggccctgtataacgaaatggacccggac
gagcgctggaaggctgcctacacgcggcacctgcggccagacatgaagacgcacttggac
cggccgctggtggtggacccgcaggagaaccgcaacaacaacaccaacaagagccgggcg
gccgagcccaccgtggaccagcgcctcggccagcagcgcgccgaggacttcctcaggaaa
caggcccgctaccacgatcgggcccgggaccccagcggctcggcgggtgtccacagccct
ctgcagaaggatgcccaagtgatcagctggcacaagaacgccatgcacagcaggtgttat
gcaactggccacctattccaggcagaggatgccagatccccagggagaaggggagagaac
cagggctccggggtccctgtgtcgggtcccaacctgtcaaccacccggccaatccagcag
gacctgggccgccaagacccacccctggcagaggatattgacaacatgaagaacaacaag
ctggccaccgcggagtcggccgctccccacggcagccttggccacgccggcctgccccag
agcccagccaagatgggaaacagcaccgaccccggccccacgccggccatccctgccatg
gccaccaacctgaacaaaaacgccaacccagacccactgccaaaaaaagaggaagagaag
aaggaggaggaggaagacgaccgtggggaagacggccctaagccaatgcctccctatagc
tccatgttcatcctgtccacgaccaacccccttcgccgcctgtgccattacatcctgaac
ctgcgctactttgagatgtgcatcctcatggtcattgccatgagcagcatcgccctggcc
gccgaggaccctgtgcagcccaacgcacctcggaacaacgtgctgcgatattttgactac
gtttttacaggcgtctttacctttgagatggtgatcaagatgattgacctggggctcgtc
ctgcatcagggtgcctacttccgtgacctctggaatattctcgacttcatagtggtcagt
ggggccctggtagcctttgccttcactggcaatagcaaaggaaaagacatcaacacgatt
aaatccctccgagtcctccgggtgctacgacctcttaaaaccatcaagcggctgccaaag
ctcaaggctgtgtttgactgtgtggtgaactcgcttaaaaacgtcttcaacatcctcatc
gtctacatgctattcatgttcatcttcgccgtggtggctgtgcagctcttcaaggggaaa
ttcttccactgcactgacgagtccaaagagtttgagaaagattgtcgaggcaaatacctc
ctctacgagaagaatgaggtgaaggcgcgagatcgggagtggaagaagtatgaattccat
tacgacaatgtgctgtgggctctgctgaccctcttcaccgtgtccacgggagaaggctgg
ccacaggtcctcaagcattcggtggacgccacctttgagaaccagggccccagccccggg
taccgcatggagatgtccattttctacgtcgtctactttgtggtgttccccttcttcttt
gtcaatatctttgtggccttgatcatcatcaccttccaggagcaaggggacaagatgatg
gaggaatacagcctggagaaaaatgagagggcctgcattgattttgccatcagcgccaag
ccactgacccgacacatgccgcagaacaagcagagcttccagtaccgcatgtggcagttc
gtggtgtctccacctttcgagtacacgatcatggccatgatcgccctcaacaccatcgtg
cttatgatgaagttctatggggcttcagttgcttatgaaaatgccctgagggtgttcaac
atcgtcttcacctccctcttctctctggaatgtgtgctgaaagtcatggcttttgggatt
ctgaattatttccgcgatgcctggaacatcttcgactttgtgactgttctgggcagcatc
accgatatcctcgtgactgagtttgggaatccgaataacttcatcaacctgagctttctc
cgcctcttccgagctgcccggctcatcaaacttctccgtcagggttacaccatccgcatt
cttctctggacctttgtgcagtccttcaaggccctgccttatgtctgtctgctgatcgcc
atgctcttcttcatctatgccatcattgggatgcaggtgtttggtaacattggcatcgac
gtggaggacgaggacagtgatgaagatgagttccaaatcactgagcacaataacttccgg
accttcttccaggccctcatgcttctcttccggggcgcaccctcacccttcttttccgtg
agcatcacctctccattccccagtctttttctgtctctgtctcatttcctttccccatct
tctctctatccctctctccatctgggcgtctgtgtacatgtctttgggtctgtctgtctg
tctgtctgtatccttctcactcactcattcattccctcggtctctgcccccactctctct
tggtccccggggtccccacagatgctgaatctctttgtcgccgtcatcatggacaacttt
gagtacctcacccgagactcctccatcctgggcccccaccacctggatgagtacgtgcgt
gtctgggccgagtatgaccccgcagcttggggccgcatgccttacctggacatgtatcag
atgctgagacacatgtctccgcccctgggtctggggaagaagtgtccggccagagtggct
tacaagcggcttctgcggatggacctgcccgtcgcagatgacaacaccgtccacttcaat
tccaccctcatggctctgatccgcacagccctggacatcaagattgccaagggaggagcc
gacaaacagcagatggacgctgagctgcggaaggagatgatggcgatttggcccaatctg
tcccagaagacgctagacctgctggtcacacctcacaagtccacggacctcaccgtgggg
aagatctacgcagccatgatgatcatggagtactaccggcagagcaaggccaagaagctg
caggccatgcgcgaggagcaggaccggacacccctcatgttccagcgcatggagcccccg
tccccaacgcaggaagggggacctggccagaacgccctcccctccacccagctggaccca
ggaggagccctgatggctcacgaaagcggcctcaaggagagcccgtcctgggtgacccag
cgtgcccaggagatgttccagaagacgggcacatggagtccggaacaaggcccccctacc
gacatgcccaacagccagcctaactctcagtccgtggagatgcgagagatgggcagagat
ggctactccgacagcgagcactacctccccatggaaggccagggccgggctgcctccatg
ccccgcctccctgcagagaaccagaggagaaggggccggccacgtgggaataacctcagt
accatctcagacaccagccccatgaagcgttcagcctccgtgctgggccccaaggcccga
cgcctggacgattactcgctggagcgggtcccgcccgaggagaaccagcggcaccaccag
cggcgccgcgaccgcagccaccgcgcctctgagcgctccctgggccgctacaccgacgtg
gacacaggcttggggacagacctgagcatgaccacccaatccggggacctgccgtcgaag
gagcgggaccaggagcggggccggcccaaggatcggaagcatcgacagcaccaccaccac
caccaccaccaccaccccccgcccccagacaaggaccgctatgcccaggaacggccagac
cacggccgggcacgggctcgggaccagcgctggtcccgctcgcccagcgagggccgagag
cacatggcgcaccggcaggtgggtgcggctgcaagtgaccccaggctgggctcggccggg
aggcggggaggagagaaggggataccccatccaacagccactctgggcaaaggtccccgg
atcccggctgtgaccacctcccatcctgcccccaagccaccggggtgcccggcggccgga
gcggacacggatccccaccacaccagctgcctatgctgtccccccagcccccttgcccac
ccgccgccccctccccgccgcccgcagctgcttcctcctcggttgtggatcatatttgag
ttctgggccgggggcggcgaggaggccatggccagggcctacgacgcgccaccccccgta
cgacacgcgtcctcgggcgccaccgggcgctcgcccaggactccccgggcctcgggcccg
gcctgcgcctcgccttctcggcacggccggcgactccccaacggctactacccggcgcac
ggactggccaggccccgcgggccgggctccaggaagggcctgcacgaaccctacagcgag
agtgacgatgattggtgctaa

KEGG   Pan paniscus (bonobo): 100973580
Entry
100973580         CDS       T02283                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04020  Calcium signaling pathway
pps04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100973580 (CACNA1E)
   04020 Calcium signaling pathway
    100973580 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100973580 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100973580 (CACNA1E)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100973580 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 100973580
NCBI-ProteinID: XP_003824779
Position
1
AA seq 2270 aa
MARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQAAAYKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGVSYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRKHMQMSSQEALNREEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGL
ALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG
GGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAMPTEGEKDH
ELRGNHGAKEPTIQEERAQDLRRTNSLMVSRGSRLAGGLDEADTPLVLPHPELEVGKHVV
LTEQEPEGSSEQALLGNVQLDMGRVISQSEPDLSCITANTDKATTESTSVTVAIPDVDPL
VDSTVVHISNKTDGEASPLKEAEIREDEEEVEKKKQKKEKRETGKAMVPHSSMFIFSTTN
PIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFE
MVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVL
RVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTD
SSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQH
SVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLE
KNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYY
SAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILT
DSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFI
YAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEP
DTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHH
LDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAED
MTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKA
SDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPY
LQQDPVSGLSGRSGYPSMSPLSPQDIFQLACMDPADDGQFQERQSLVVTDPSSMRRSFST
IRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRER
GRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSI
PSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHAGSISPPADGSEEGSPLTSQALESN
NACLTESSNSPHPQQSQHASPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRS
NTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVNNLLSDTEEDDKC
NT seq 6813 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcgccaggccagggtccggcgatggagactcggac
cagagcaggaaccggcaaggaacccccgtgccggcctcggggcaggcggccgcctacaag
cagacgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tatgccaagaagctcatcgattggccgccatttgagtacatgatcctggccaccatcatt
gccaactgcatcgtcctggccctggagcagcatcttcctgaggatgacaagacccccatg
tcccgaagactggagaagacagaaccttatttcattgggatcttttgctttgaagctggg
atcaaaattgtggccctggggttcatcttccataagggctcatacctccgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggccactgcaggaacccacttc
aatactcatgtggacctgaggaccctccgggctgtgcgtgtcctgcggcccttgaagctc
gtgtcagggatacctagcctgcagattgtgttgaagtccatcatgaaggccatggtacct
cttctgcagattggccttctgctcttctttgccatcctgatgtttgctatcattggtttg
gagttctacagtggcaagttacatcgagcatgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccatgtggtgtgcagggctgcccagctggttatgaatgcaag
gactggatcggccccaatgatgggatcacccagtttgataacatcctttttgctgtgctg
actgtcttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaacctagtcctgggagtgctttccggggaatttgccaaagagagagagaga
gtggagaaccgaagggctttcatgaagctgcggcgccagcagcagattgagcgtgagctg
aatggctaccgtgcctggatagacaaagcagaggaagtcatgctcgctgaagaaaataaa
aatgctggaacatccgccttagaagtgcttcgaagggcaaccatcaagaggagccggaca
gaggccatgactcgagactccagtgatgagcactgtgttgatatctcctctgtgggcaca
cctctggcccgagccagtatcaaaagtgcaaaggtagatggggtctcttatttccggcac
aaggaaaggcttctgcgcatctccattcgccacatggttaaatcccaggtgttttactgg
attgtgctgagccttgtggcactcaacactgcctgtgtggccattgtccatcacaaccag
ccccagtggctcacccacctcctctactatgcagaatttctgtttctgggactcttcctc
ttggagatgtccctgaagatgtatggcatggggcctcgcctttattttcactcttcattc
aactgctttgattttggggtcacagtgggcagtatctttgaagtggtctgggcaatcttc
agacctggtacgtcttttggaatcagtgtcttgcgagccctccggcttctaagaatattt
aaaataaccaagtattgggcttccctacggaatttggtggtctccttgatgagctcaatg
aagtctatcatcagtttgcttttcctcctcttcctcttcatcgttgtctttgctctccta
ggaatgcagttatttggaggcaggtttaactttaatgatgggactccttcggcaaatttt
gataccttccctgcagccatcatgaccgtgttccagatcctgacgggtgaggactggaat
gaggtgatgtacaatgggatccgctcccagggtggggtcagctcaggcatgtggtctgcc
atctacttcattgtgctcaccttgtttggcaactacacgctactgaatgtgttcttggct
atcgctgtggataatctcgccaacgcccaggaactgaccaaggatgaacaggaggaagaa
gaggccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttcgatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcaccacatgtccgtgtgggagcag
cgtaccagccagctgaggaagcacatgcagatgtccagccaggaggccctcaacagagag
gaggcaccgaccatgaacccgctcaaccccctcaacccgctcagctccctcaacccgctc
aatgcccaccccagcctttatcggcgacccagggccattgagggcctggccctgggcctg
gccctggagaagttcgaggaggagcgcatcagccgtggggggtccctcaagggggatgga
ggggaccgatccagtgccctggacaaccagaggacccctttgtccctgggccagcgggag
ccaccgtggctggccaggccctgtcatggaaactgtgacccgactcagcaggaggcaggg
ggaggagaggctgtggtgacctttgaggaccgggccaggcacaggcagagccaacggcgc
agccggcatcgccgcgtcaggacagaaggcaaggagtcctcttcagcctcccggagcagg
tctgccagccaggaacgcagtctggatgaagccatgcccactgaaggggagaaggaccat
gagctcaggggcaaccatggtgccaaggagccaacgatccaagaagagagagcccaggat
ttaaggaggaccaacagtctgatggtgtccagaggctccaggctggcaggaggccttgat
gaggctgacacccccctagtcctgccccatcctgagttggaagtggggaagcacgtggtg
ctgacggagcaggagccagaaggcagcagtgagcaggccctgctggggaatgtgcagcta
gacatgggccgggtcatcagccagagcgagcccgacctctcctgcatcacggccaacacg
gacaaggccaccaccgagagcaccagcgtcaccgtcgccatccccgacgtggaccccttg
gtggactcaaccgtggtgcacattagcaacaagacggatggggaagccagtcccttgaag
gaggcagagatcagagaggatgaggaggaggtggagaagaagaagcagaagaaggagaag
cgtgagacaggcaaagccatggtgccccacagctcaatgttcatcttcagcaccaccaac
ccgatccggagggcctgccactacatcgtgaacctgcgctactttgagatgtgtatcctc
ctggtgattgcagccagcagcatcgccctggcggcagaggaccccgtcctgaccaactcg
gagcgcaacaaagtcctgaggtattttgactatgtgttcacgggcgtgttcacctttgag
atggttataaagatgatagaccaaggcttgatcctgcaggatgggtcctacttccgagac
ttgtggaacatcctggactttgtggtggtcgttggcgcattggtggcctttgctctggcg
aacgctttgggaaccaacaaaggacgggacatcaagaccatcaagtctctgcgggtgctc
cgagttctaaggccactgaaaaccatcaagcgcttgcccaagctcaaggccgtcttcgac
tgcgtagtgacctccttgaagaatgtcttcaacatactcattgtgtacaagctcttcatg
ttcatctttgctgtcatcgcagttcagctcttcaagggaaagttcttttattgcacggac
agttccaaggacacagagaaggagtgcataggcaactatgtagatcatgagaaaaacaag
atggaggtgaagggccgggaatggaagcgccatgaattccactacgacaacattatctgg
gccctgctgaccctcttcaccgtctccacaggggaaggatggcctcaagttctgcagcac
tctgtagatgtgacagaggaagaccgaggcccaagccgcagcaaccgcatggagatgtct
atcttttatgtggtctactttgtggtcttccccttcttctttgtcaatatctttgtggct
ctcatcatcatcaccttccaggagcaaggggataagatgatggaggagtgcagcctggag
aagaatgagagggcgtgcatcgacttcgccatcagcgccaaacctctcacccgctacatg
ccgcagaacagacacaccttccagtaccgcgtgtggcactttgtggtgtctccgtccttt
gagtacaccattatggccatgatcgccttgaataccgttgtgctgatgatgaagtattac
tctgctccctgtacctatgagctggccctgaagtacctgaatatcgccttcaccatggtg
ttttccctggaatgtgtcctgaaggtcatcgcttttggctttttgaactatttccgagac
acctggaatatctttgacttcatcaccgtgattggcagtatcacagaaattatcctgaca
gacagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctcttccgagct
gcccgcctcataaagctcctgcgtcagggctataccatacgcattttgctgtggaccttt
gtgcagtcctttaaggccctcccttatgtctgccttttaattgccatgcttttcttcatt
tatgccatcattgggatgcaggtatttggaaacataaaattagacgaggagagtcacatc
aaccggcacaacaacttccggagtttctttgggtccctaatgctactcttcaggagtgcc
acaggtgaagcctggcaggagattatgctgtcatgccttggggagaagggctgtgagcct
gacaccaccgcaccatcagggcagaacgagaacgaacgctgcggcaccgatctggcctac
gtgtactttgtctccttcatcttcttctgctccttcttgatgctcaacctgttcgtggcc
gtcatcatggacaactttgagtacctgactcgggactcctccatcctggggcctcaccac
ttggacgagtttgtccgcgtctgggcagaatatgaccgagcagcatgtggccgcatccat
tacactgagatgtatgaaatgctgactctcatgtcacctccgctaggcctcggcaagaga
tgtccctccaaagtggcatataagaggttggtcctgatgaacatgccagtagctgaggac
atgacggtccacttcacctccacacttatggctctgatccggacagctctggacattaaa
attgccaaaggtggtgcagacaggcagcagctagactcagagctacaaaaggagacccta
gccatctggcctcacctatcccagaagatgctggatctgcttgtgcccatgcccaaagcc
tctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactataagcag
agtaaggtgaagaagcagaggcagcagctggaggaacagaaaaatgcccccatgttccag
cgcatggagccttcatctctgcctcaggagatcattgctaatgccaaagccctgccttac
ctccagcaggaccccgtttcaggcctgagtggccggagtggatacccttcgatgagtcca
ctctctccccaggatatattccagttggcttgtatggaccccgccgatgatggacagttc
caagaacggcagtctctggtggtgacagaccctagctccatgagacgttcattttccact
attcgggataagcgttcaaattcctcgtggttggaggaattctccatggagcgaagcagt
gaaaatacctacaagtcccgtcgccggagttaccactcctccttgcggctgtcagcccac
cgcctgaactctgattcaggccacaagtctgacactcaccgctcagggggcagggagcgg
ggacggtcaaaagagcgaaagcatcttctctctcctgatgtctcccgctgcaattcagaa
gagcgagggacccaggctgactgggagtccccagagcgccgtcaatccaggtcacccagt
gagggcaggtcacagacgcccaacagacagggcacaggttccctaagtgagagctccatc
ccctctgtctctgacaccagcaccccaagaagaagtcgtcggcagctcccacccgtcccg
ccaaagccccggcccctcctttcctacagctccctgattcgacacgcgggcagcatctct
ccacctgctgatggaagcgaggagggctccccgctgacctcccaagctctggagagcaac
aatgcttgcctgaccgagtcttccaactctccgcacccccagcagagccaacatgcctcc
ccacagcgctacatctccgagccctacttggccctgcacgaagactcccatgcctcagac
tgtggtgaggaggagacgctcactttcgaagcagccgtggctactagcctgggccgttcc
aacaccatcggctcagccccacccctgcggcatagctggcagatgcccaacgggcactat
cggcggcggaggcgcgggggccctgggccaggcatgatgtgtggggctgtcaacaacctg
ctaagtgacacggaagaagatgacaaatgctag

KEGG   Pan paniscus (bonobo): 100979369
Entry
100979369         CDS       T02283                                 

Gene name
CACNA1B
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 B
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04020  Calcium signaling pathway
pps04721  Synaptic vesicle cycle
pps04723  Retrograde endocannabinoid signaling
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04727  GABAergic synapse
pps04728  Dopaminergic synapse
pps04930  Type II diabetes mellitus
pps05016  Huntington disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05032  Morphine addiction
pps05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100979369 (CACNA1B)
   04020 Calcium signaling pathway
    100979369 (CACNA1B)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100979369 (CACNA1B)
   04725 Cholinergic synapse
    100979369 (CACNA1B)
   04728 Dopaminergic synapse
    100979369 (CACNA1B)
   04726 Serotonergic synapse
    100979369 (CACNA1B)
   04723 Retrograde endocannabinoid signaling
    100979369 (CACNA1B)
   04721 Synaptic vesicle cycle
    100979369 (CACNA1B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100979369 (CACNA1B)
   05020 Prion disease
    100979369 (CACNA1B)
   05022 Pathways of neurodegeneration - multiple diseases
    100979369 (CACNA1B)
  09165 Substance dependence
   05032 Morphine addiction
    100979369 (CACNA1B)
   05033 Nicotine addiction
    100979369 (CACNA1B)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100979369 (CACNA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100979369 (CACNA1B)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100979369 (CACNA1B)
SSDB
Motif
Pfam: Ion_trans PKD_channel GPHH
Other DBs
NCBI-GeneID: 100979369
NCBI-ProteinID: XP_014201808
Position
9
AA seq 1590 aa
MGAGSEGDQAASARRGAPDPVVSDLPETAWRWLLHWALLASASCFPPCGVCRPVLNSRTP
FEYMILATIIANCIVLALEQHLPDGDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVF
HKGSYLRNGWNVMDFVVVLTGILATAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSI
MKAMVPLLQIGLLLFFAILMFAIIGLEFYMGKFHKACFPNSTDAEPVGDFPCGKEAPARL
CEGDTECREYWPGPNFGITNFDNILFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYF
IPLIIIGSFFMLNLVLGVLSGEFAKERERVENRRAFLKLRRQQQIERELNGYLEWIFKAE
EVMLAEEDRNAEEKSPLDAVLKRAATKKSRNDLIHAEEGEDRFADLCAVGSPFARASLKS
GKTESSSYFRRKEKMFRFFIRRMVKAQSFYWVVLCVVALNTLCVAMVHYNQPRRLTTTLY
FAEFVFLGLFLTEMSLKMYGLGPRSYFRSSFNCFDFGVIVGSVFEVVWAAIKPGSSFGIS
VLRALRLLRIFKVTKYWSSLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQF
NFQDETPTTNFDTFPAAILTVFQILTGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLF
GNYTLLNVFLAIAVDNLANAQELTKDEEEMEEAANQKLALQKAKEVAEVSPMSAANISIA
AFVKQARGTVSRSSSVSSVNSPRQQNSAKARSVWEQRASQLRLQNLRASCEALYSEMDPE
ERLRFATTRHLRPDMKTHLDRPLVVELGRDGARGPWEAKPDLRLRRPPRAARHKAQPAHE
AVEKEATEKEAEIVEADKEKELRNHQPREPHCDLETSGTVTVGPMHTLPSTCLQKVEEQP
EDADNQRNVTRMGSQPPDPNTIVHIPVMLTGPPGEATVVPSGNVDLESQAEGKKEVEADD
VMRSGPRPIVPYSSMFCLSPTNLLRRFCHYIVTMRYFEMVILVVIALSSIALAAEDPVRT
DSPRNNALKYLDYIFTGVFTFEMVIKMIDLGLLLHPGAYFRDLWNILDFIVVSGALVAFA
FSSFVGGSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYML
FMFIFAVIAVQLFKGKFFYCTDESKELERDCRGQYLDYEKEEVEAQPRQWKKYDFHYDNV
LWALLTLFTVSTGEGWPMVLKHSVDATYEEQGPSPGYRMELSIFYVVYFVVFPFFFVNIF
VALIIITFQEQGDKVMSECSLEKNERACIDFAISAKPLTRYMPQNRQSFQYKTWTFVVSP
PFEYFIMAMIALNTVVLMMKFYDAPYEYELMLKCLNIVFTSMFSMECVLKIIAFGVLNYF
RDAWNVFDFVTVLGSITDILVTEIAETNNFINLSFLRLFRAARLIKLLRQGYTIRILLWT
FVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALDDDTSINRHNNFRTFLQALMLLFRS
ATGEAWHEIMLSCLSNQACDEQANATECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNF
EYLTRDSSILGPHHLDEFIRVWAEYDPAAW
NT seq 4773 nt   +upstreamnt  +downstreamnt
atgggggcagggagtgagggagaccaggccgcgtccgccaggagaggggctccggaccca
gttgtctcagaccttccggagacggcctggcggtggctgctgcactgggctctgctggcg
tcggcctcgtgtttccctccgtgcggcgtctgccggccagtccttaactcacgcactcca
ttcgagtatatgatcttggccaccatcatcgccaactgcatcgtgctggccctggagcag
cacctccctgatggggacaaaacgcccatgtccgagcggctggacgacacggagccctat
ttcatcgggatcttttgctttgaggcagggatcaaaatcatcgctctgggctttgtcttc
cacaagggctcttacctgcggaacggctggaacgtcatggacttcgtggtcgtcctcaca
gggatccttgccacggctggaactgacttcgacctgcgaacactgagggctgtgcgtgtg
ctgaggcccctgaagctggtgtctgggattccaagtttgcaggtggtgctcaagtccatc
atgaaggccatggttccactcctgcagattgggctgcttctcttctttgccatcctcatg
tttgccatcattggcctggagttctacatgggcaagttccacaaggcctgtttccccaac
agcacagatgcggagcccgtgggtgacttcccctgtggcaaggaggccccagcccggctg
tgcgagggcgacactgagtgccgggagtactggccaggacccaacttcggcatcaccaac
tttgacaatatcctgtttgccatcttgacggtgttccagtgcatcaccatggagggctgg
actgacatcctctataatacaaacgatgcggccggcaacacctggaactggctctacttc
atccctctcatcatcatcggctccttcttcatgctcaacctggtgctgggcgtgctctcg
ggggagtttgccaaggagcgagagagggtggagaaccgccgtgccttcctgaagctgcgc
cggcagcagcagatcgagcgagagctcaacgggtacctggagtggatcttcaaggcggag
gaagtcatgctggccgaggaggacaggaatgcagaggagaagtcccctttggacgcagtg
ctgaagagagcggccaccaagaagagcagaaatgacctgattcacgcagaggagggagag
gaccggtttgcagatctctgtgctgttggatcccccttcgcccgcgccagcctcaagagc
gggaagacagagagctcgtcatacttccggaggaaggagaagatgttccggttttttatc
cggcgcatggtgaaggctcagagcttctactgggtggtgctgtgcgtggtggccctgaac
acactgtgtgtggccatggtgcattacaaccagccgcggcggcttaccacgaccctgtat
tttgcagagtttgttttcctgggtctcttcctcacagagatgtccctgaagatgtatggc
ctggggcccagaagctacttccggtcctccttcaactgcttcgactttggggtcatcgtg
gggagcgtctttgaagtggtctgggcggccatcaagccgggaagctcctttgggatcagt
gtgctgcgggccctccgcctgctgaggatcttcaaagtcacgaagtactggagctccctg
cggaacctggtggtgtccctgctgaactccatgaagtccatcatcagcctgctcttcttg
ctcttcctgttcattgtggtcttcgccctgctggggatgcagctgtttgggggacagttc
aacttccaggatgagactcccacaaccaacttcgacaccttccctgccgccatcctcact
gtcttccagatcctgacgggagaggactggaatgcagtgatgtatcacgggatcgaatcg
caaggcggcgtcagcaaaggcatgttctcgtccttttacttcattgtcctgacactgttc
ggaaactacactctgctgaatgtctttctggccatcgctgtggacaacctggccaacgcc
caagagctgaccaaggatgaagaggagatggaagaagcagccaatcagaagcttgctctg
caaaaggccaaagaagtggctgaagtcagccccatgtctgccgcgaacatctccatcgct
gcttttgtaaagcaagctcgaggtactgtatctcgcagctcatctgtctccagcgtgaac
tcacccaggcagcagaactcggccaaggcgcgctcggtgtgggagcagcgggccagccag
ctacggctgcagaacctgcgggccagctgcgaggcgctgtacagcgagatggaccccgag
gagcggctgcgcttcgccactacgcgccacctgcggcccgacatgaagacgcacctggac
cggccgctggtggtggagctgggccgcgacggcgcgcggggcccgtgggaggcaaagccc
gacctgaggctgcggaggcccccgagggcggcccggcacaaggcgcagcctgctcacgag
gctgtggagaaggaggccacggagaaggaggctgagatagtggaagccgataaggaaaag
gagctccggaaccaccagcccagggagccacactgtgacctggagaccagtgggactgtg
actgtgggccctatgcacacactgcccagcacctgtctccagaaggtggaggaacagcca
gaggatgcagacaatcagcggaacgtcactcgcatgggcagtcagcccccagacccgaac
actatcgtacatatcccagtgatgctgacgggccctcctggggaagccacggtcgttccc
agtggtaacgtggacctggaaagccaagcagaggggaagaaggaggtggaagcggatgac
gtgatgaggagcggcccccggcctatcgtcccgtacagctccatgttctgtttaagcccc
accaacctgctccgccgcttctgccactacatcgtgaccatgaggtacttcgagatggtc
attctcgtggtcatcgccttgagcagcatcgccctggctgctgaggacccagtgcgcaca
gactcgcccaggaacaatgctctgaaatacctggattacattttcactggtgtctttacc
tttgagatggtgataaagatgatcgacttgggactgctgcttcaccctggagcctatttc
cgggacttgtggaacattctggacttcattgtggtcagtggcgccctggtggcgtttgct
ttctcgagcttcgtgggaggatccaaagggaaagacatcaataccatcaagtctctgaga
gtccttcgtgtcctgcggcccctcaagaccatcaaacggctgcccaagctcaaggctgtg
tttgactgtgtggtgaactccctgaagaatgtcctcaacatcttgattgtctacatgctc
ttcatgttcatatttgccgtcattgcggtgcagctcttcaaagggaagtttttctactgc
acagatgaatccaaggagctggagagagactgcaggggtcagtatttggattatgagaag
gaggaagtggaagctcagcccaggcagtggaagaaatacgactttcactacgacaatgtg
ctctgggctctgctgacgctgttcacagtgtccacgggagaaggctggcccatggtgctg
aaacactccgtggatgccacttatgaggagcaggggccaagccctgggtaccgcatggag
ctgtccatcttctacgtggtctactttgtggtctttcccttcttcttcgtcaacatcttt
gtggccttgatcatcatcaccttccaggagcagggggacaaggtgatgtctgaatgcagc
ctggagaagaacgagagggcttgcattgacttcgccatcagcgccaaacccctgacacgg
tacatgccccaaaaccggcagtcgttccagtataagacgtggacatttgtggtctcccca
ccctttgagtacttcatcatggccatgatagccctcaacactgtggtgctgatgatgaag
ttctatgatgcaccctatgagtacgagctgatgctgaaatgcctgaacatcgtgttcaca
tccatgttctccatggaatgcgtgctgaagatcatcgcctttggggtgctgaactatttc
agagatgcctggaatgtctttgactttgtcactgtgttgggaagtattactgatatttta
gtaacagagattgcggaaacgaacaatttcatcaacctcagcttcctccgcctcttccga
gctgcgcggctgatcaagctgctccgccagggctacaccatccgcatcctgctgtggacc
tttgtccagtccttcaaggccctgccctacgtgtgtctgctcattgccatgctgttcttc
atctacgccatcatcggcatgcaggtgtttgggaatattgccctggatgatgacaccagc
atcaaccgccacaacaacttccggacgtttttgcaagccctgatgctgctgttcaggagc
gccacgggggaggcctggcacgagatcatgctgtcctgcctgagcaaccaggcctgtgat
gagcaggccaatgccaccgagtgtggaagtgactttgcctacttctacttcgtctccttc
atcttcctgtgctcctttctgatgttgaacctctttgtggctgtgatcatggacaatttt
gagtaccttacgcgggactcttccatcctaggtcctcaccacttggatgagttcatccgg
gtctgggctgaatacgacccggctgcgtggtaa

DBGET integrated database retrieval system