KEGG   Pan paniscus (bonobo): 100972044
Entry
100972044         CDS       T02283                                 

Gene name
CFLAR
Definition
(RefSeq) CASP8 and FADD like apoptosis regulator
  KO
K04724  CASP8 and FADD-like apoptosis regulator
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04064  NF-kappa B signaling pathway
pps04140  Autophagy - animal
pps04210  Apoptosis
pps04217  Necroptosis
pps04668  TNF signaling pathway
pps05142  Chagas disease
pps05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100972044 (CFLAR)
   04668 TNF signaling pathway
    100972044 (CFLAR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100972044 (CFLAR)
  09143 Cell growth and death
   04210 Apoptosis
    100972044 (CFLAR)
   04217 Necroptosis
    100972044 (CFLAR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100972044 (CFLAR)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100972044 (CFLAR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100972044 (CFLAR)
Peptidases and inhibitors [BR:pps01002]
 Cysteine peptidases
  Family C14: caspase family
   100972044 (CFLAR)
SSDB
Motif
Pfam: DED Peptidase_C14 MarR_2 HTH_20
Other DBs
NCBI-GeneID: 100972044
NCBI-ProteinID: XP_003820773
UniProt: A0A2R8ZTA9
Position
2B
AA seq 480 aa
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLY
RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYM
GRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGT
SYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGTQQEPVKKSIQESEAFLPQSIP
EERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP
EHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNY
VVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP
SLYLQCLSQKLRQERKRSLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgtctgctgaagtcatccatcaggttgaagaagcacttgatacagatgagaaggagatg
ctgctctttttgtgccgggatgttgctatagatgtggttccacctaatgtcagggacctt
ctggatattttacgggaaagaggtaagctgtctgtcggggacttggctgaactgctctac
agagtgaggcgatttgacctgctcaaacgtatcttgaagatggacagaaaagctgtggag
acccacctgctcaggaaccctcaccttgtttcggactatagagtgctgatggcagagatt
ggtgaggatttggataaatctgatgtgtcctcattaattttcctcatgaaggattacatg
ggccgaggcaagataagcaaggagaagagtttcttggaccttgtggttgagttggagaaa
ctaaatctggttgccccagatcaactggatttattagaaaaatgcctaaagaacatccac
agaatagacctgaagacaaaaatccagaagtacaagcagtctgttcaaggagcagggaca
agttacaggaatgttctccaagcagcaatccaaaagagtctcaaggatccttcaaataac
ttcaggctccataatgggagaagtaaagaacaaagacttaaggaacagcttggcactcaa
caagaaccagtgaagaaatccattcaggaatcagaagcttttttgcctcagagcatacct
gaagagagatacaagatgaagagcaagcccctaggaatctgcctgataatcgattgcatt
ggcaatgagacagagcttcttcgagacaccttcacttccctgggctatgaagtccagaaa
ttcttgcatctcagtatgcatggtatatcccagattcttggccaatttgcctgtatgccc
gagcaccgagactacgacagctttgtgtgtgtcctggtgagccgaggaggctcccagagt
gtgtatggtgtggatcagactcactcagggctccccctgcatcacatcaggaggatgttc
atgggagattcatgcccttatctagcagggaagccaaagatgttttttattcagaactat
gtggtgtcagagggccagctggaggacagcagcctcttggaggtggatgggccagcgatg
aagaatgtggaattcaaggctcagaagcgagggctgtgcacagttcaccgagaagctgac
ttcttctggagcctgtgtactgcggacatgtccctgctggagcagtctcacagctcaccg
tccctgtacctgcagtgcctctcccagaaactgagacaagaaagaaaacgctcactcctg
gatcttcacattgaactcaatggctacatgtatgattggaacagcagagtttctgccaag
gagaaatattatgtctggctgcagcacactctgagaaagaaacttatcctctcctacaca
taa

DBGET integrated database retrieval system