KEGG   Pan paniscus (bonobo): 100972246
Entry
100972246         CDS       T02283                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps03013  RNA transport
pps04012  ErbB signaling pathway
pps04066  HIF-1 signaling pathway
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04211  Longevity regulating pathway
pps04218  Cellular senescence
pps04910  Insulin signaling pathway
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05168  Herpes simplex virus 1 infection
pps05207  Chemical carcinogenesis - receptor activation
pps05221  Acute myeloid leukemia
pps05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100972246 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100972246 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    100972246 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    100972246 (EIF4EBP1)
   04152 AMPK signaling pathway
    100972246 (EIF4EBP1)
   04150 mTOR signaling pathway
    100972246 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100972246 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100972246 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    100972246 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100972246 (EIF4EBP1)
   05231 Choline metabolism in cancer
    100972246 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100972246 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100972246 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    100972246 (EIF4EBP1)
   05165 Human papillomavirus infection
    100972246 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100972246 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pps03019]
    100972246 (EIF4EBP1)
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100972246 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 100972246
NCBI-ProteinID: XP_008954494
Position
8
AA seq 151 aa
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEAIQSHLRNSPEDKRAGGECRGLARLYLG
KGNGTCPLLFVNTSRYLLVPPLMQELPPQGE
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtccgggggcagcagctgcagccagaccccaagccgggccatccccgccactcgccgg
gtggtgctcggcgacggcgtgcagctcccgcccggggactacagcacgacccccggtggc
acgctcttcagcaccaccccgggaggtaccaggatcatctatgaccggaaattcttgatg
gagtgtcggaactcacctgtgaccaaaacacccccaagggatctgcccaccattcccggg
gtcaccagcccttccagtgatgagccccccatggaagccatccagagccacctgcgcaat
agcccagaagataagcgggcgggcggtgagtgtcggggcttggccaggctctaccttggg
aaagggaatggcacctgccccctcctcttcgtgaacaccagcagatacctccttgtgcct
ccactgatgcaggagctgccaccccaaggggagtga

DBGET integrated database retrieval system