KEGG   Pan paniscus (bonobo): 100972356
Entry
100972356         CDS       T02283                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps01522  Endocrine resistance
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04072  Phospholipase D signaling pathway
pps04114  Oocyte meiosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04727  GABAergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04962  Vasopressin-regulated water reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04976  Bile secretion
pps05032  Morphine addiction
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100972356 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100972356 (ADCY9)
   04371 Apelin signaling pathway
    100972356 (ADCY9)
   04020 Calcium signaling pathway
    100972356 (ADCY9)
   04072 Phospholipase D signaling pathway
    100972356 (ADCY9)
   04024 cAMP signaling pathway
    100972356 (ADCY9)
   04022 cGMP-PKG signaling pathway
    100972356 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100972356 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100972356 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100972356 (ADCY9)
   04062 Chemokine signaling pathway
    100972356 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    100972356 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    100972356 (ADCY9)
   04912 GnRH signaling pathway
    100972356 (ADCY9)
   04913 Ovarian steroidogenesis
    100972356 (ADCY9)
   04915 Estrogen signaling pathway
    100972356 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    100972356 (ADCY9)
   04921 Oxytocin signaling pathway
    100972356 (ADCY9)
   04926 Relaxin signaling pathway
    100972356 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    100972356 (ADCY9)
   04918 Thyroid hormone synthesis
    100972356 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    100972356 (ADCY9)
   04916 Melanogenesis
    100972356 (ADCY9)
   04925 Aldosterone synthesis and secretion
    100972356 (ADCY9)
   04927 Cortisol synthesis and secretion
    100972356 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100972356 (ADCY9)
   04270 Vascular smooth muscle contraction
    100972356 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    100972356 (ADCY9)
   04971 Gastric acid secretion
    100972356 (ADCY9)
   04972 Pancreatic secretion
    100972356 (ADCY9)
   04976 Bile secretion
    100972356 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100972356 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100972356 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    100972356 (ADCY9)
   04727 GABAergic synapse
    100972356 (ADCY9)
   04725 Cholinergic synapse
    100972356 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    100972356 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100972356 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    100972356 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    100972356 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100972356 (ADCY9)
   04714 Thermogenesis
    100972356 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972356 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100972356 (ADCY9)
   05163 Human cytomegalovirus infection
    100972356 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    100972356 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100972356 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100972356 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100972356 (ADCY9)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100972356 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 zf-C2HC_2 DUF1053 AC_N
Other DBs
NCBI-GeneID: 100972356
NCBI-ProteinID: XP_003815179
UniProt: A0A2R8ZJ01
Position
16
AA seq 1353 aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTAAARPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWELLSRALLHGCIHAIGVHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAPQNGCQDEHKN
STKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASPTFSSLLDVFLSTTVFLTLSTTCFLKYEAATVPPPPAALAVFSAALLLEVLSLAVSIR
MVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHVTSEYETNIHFPVFTGS
AALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSVLTSPLDAVQNFSSER
NPCNSSVPRDLRRPASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDHGVIPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQYVDKTSLGSDSSTQAKDAHLSPKRPWKEPVKAEE
RGRFGKAIEKDDCDETGIEEANELTKLNVSKSV
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcatcaccacagcaccgaggtgagctgcgac
tccagcggggacagcaacagcgtgcgcgtcaagatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaaatacagcatctcctctagctgcagcagctctggggactcc
gggggcgtcccccggcgagtgggcggcggaggccggctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccgctggtgggaccccaagttcgactcggtgaacctg
gaggaggcctgcctggagcgctgcttcccgcagacccagcgccggttccgatatgcgctc
ttctacatcggcttcgcctgccttctgtggagcatctattttgcggtccacatgagatcc
agactgatcgtcatggtcgcccccgcgctgtgcttcctcctggtgtgtgtgggcttcttt
ctgtttaccttcaccaagctgtacgcccggcattacgcgtggacctcgctggctctcacc
ctgctggtgttcgccctgaccctggctgcgcagttccaggtcttgacgcctgtctcagga
cgcggcgacagctccaaccttacggccgcagcccggcccacagatacttgcttatctcaa
gtggggagcttctccatgtgcatcgaagtgctctttttgctctataccgtcatgcactta
cctttgtacctgagcttgtgtctgggggtggcctactctgtccttttcgagacctttggc
taccatttccgggatgaagcctgcttcccctcgcccggagccggggccctgcactgggag
ctgctgagcagggcgctgctccacggctgcatccacgccatcggggtccacctgttcgtc
atgtcccaggtgaggtccaggagcaccttcctcaaggtggggcaatccattatgcacggg
aaggacctggaagtggaaaaagccctcaaagagaggatgattcattccgtgatgccaaga
atcatagccgatgacttaatgaagcagggagatgaggagagtgagaattctgtcaagagg
catgccacctcgagccccaagaacaggaagaaaaagtcttccatccaaaaagctcctata
gccttccgcccttttaagatgcagcagatcgaagaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaacaagtctgcccacgccctggtgggtctcctgaac
gatctgttcggtcgcttcgaccgcctgtgtgaggagaccaagtgtgagaaaatcagcact
ctgggagactgttactactgcgtggctggctgtcccgagccccgggccgaccatgcctac
tgctgcatcgagatgggcctgggcatgatcaaggccatcgagcagttctgccaggagaag
aaggagatggtgaacatgagagtcggggtgcacacgggcaccgtcctttgcggcatcctg
ggcatgaggaggtttaaatttgacgtgtggtccaacgatgtgaacctggccaatctcatg
gagcagctgggagtggccggcaaagttcacatttctgaggccaccgcaaaatacttagat
gaccggtacgaaatggaagatgggaaagttattgaacggctgggccagagcgtggttgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtctcgc
tgcagctgtgcagaggccttgctttctggctttgaggtcattgacggctcacaggtgtcc
tcaggccctaggggacaggggacagcgtcatcagggaatgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcgtgcggaatcacatttgctcccaaa
tctgaagccggcgccgagggaggagcacctcaaaacggctgccaagacgagcataaaaac
agcaccaaggcttctggaggacctaatcccaaaactcagaacgggctcctcagccctccc
caagaggagaagctcaccaacagtcagacttctctgtgtgagatcttgcaggagaaggga
aggtgggcaggggtgagcctggaccagtcggctctccttccgctgaggttcaagaacatc
cgggagaaaacggacgcccactttgtggacgttatcaaagaagacagcctgatgaaagat
tacttttttaagccgcccattaatcagttcagcctgaacttcctggatcaggagctggag
cgatcctacaggaccagctatcaggaagaggtcataaagaactcccccgtgaagacgttt
gctagtcccaccttcagctccctcctggatgtgtttctgtcgaccacagtgtttctgacg
ctgtccaccacctgcttcctgaagtacgaggcggccaccgtgcctcccccgcccgccgcc
ctggcggtcttcagtgcagccctgctgctggaggtgctgtccctcgcggtgtccatcagg
atggtgttcttcctggaggacgtcatggcctgcaccaagcgcctgctggagtggatcgcc
ggctggctaccacgtcactgcatcggggccatcctggtgtcgctccccgcactggccgtc
tactcccatgtcacctccgaatatgagaccaacatacacttcccagtgttcacaggctcg
gccgcgctgattgccgtcgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccctcgccaccgtcgtgggggccgggccgctgctcctgctctacgtctccctgtgc
ccagacagttctgtattaacttcgccccttgacgcagtacagaatttcagttccgagagg
aacccgtgcaatagctcggtgccgcgtgacctccggcggccggccagcctcatcggccag
gaggtggttctcgtcttctttctcctgctcttgttggtctggttcctgaatcgcgaattt
gaagtcagctaccgcctccactaccacggagacgtggaagccgatcttcaccgcaccaag
atccagagcatgcgggaccaggcagactggctgctgaggaacatcatcccctaccacgtg
gctgagcagctgaaggtgtcccagacctactccaagaaccacgacagcggaggggtgatc
ttcgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggcggcaaggag
tgctaccgggtcctcaacgagctcatcggggactttgacgagctcctaagcaagccggac
tacagcagcatcgagaagatcaagaccatcggagccacgtacatggcggcgtcagggctg
aacaccgcgcaggcccaggacggcagccacccgcaggagcacctgcagatcctgttcgag
ttcgccaaggagatgatgcgcgtggtggacgacttcaacaacaacatgctgtggttcaac
ttcaagctccgcgtcggcttcaaccatgggcccctcacggcgggggtcatcggcaccacc
aagctgctgtacgacatctggggagacaccgtcaacatcgccagcaggatggacaccacc
ggcgtggagtgccgcatccaggtgagcgaagagagctaccgcgtcttgagcaagatgggc
tatgacttcgactacagagggaccgtgaatgtgaaggggaaaggccagatgaagacctac
ctgtacccaaagtgcacggatcacggggtcatcccacagcaccagctgtccatctcccca
gacatccgcgtccaggtggatggcagcatcggacggtctcccacagacgagattgccaac
ctggtgccttctgtccagtatgtggacaagacatctctgggttctgacagcagcacgcag
gccaaggatgcccacctgtcccccaagagaccgtggaaggagcccgtcaaagccgaagaa
aggggtcgatttggcaaagccatagagaaagacgactgtgacgaaacaggaatagaagaa
gccaacgaactcaccaagctcaacgtttcaaagagtgtgtga

KEGG   Pan paniscus (bonobo): 100978200
Entry
100978200         CDS       T02283                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps01522  Endocrine resistance
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04072  Phospholipase D signaling pathway
pps04114  Oocyte meiosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04727  GABAergic synapse
pps04742  Taste transduction
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04976  Bile secretion
pps05032  Morphine addiction
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100978200 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100978200 (ADCY4)
   04371 Apelin signaling pathway
    100978200 (ADCY4)
   04020 Calcium signaling pathway
    100978200 (ADCY4)
   04072 Phospholipase D signaling pathway
    100978200 (ADCY4)
   04024 cAMP signaling pathway
    100978200 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100978200 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100978200 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100978200 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100978200 (ADCY4)
   04062 Chemokine signaling pathway
    100978200 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100978200 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100978200 (ADCY4)
   04912 GnRH signaling pathway
    100978200 (ADCY4)
   04913 Ovarian steroidogenesis
    100978200 (ADCY4)
   04915 Estrogen signaling pathway
    100978200 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100978200 (ADCY4)
   04921 Oxytocin signaling pathway
    100978200 (ADCY4)
   04926 Relaxin signaling pathway
    100978200 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100978200 (ADCY4)
   04918 Thyroid hormone synthesis
    100978200 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100978200 (ADCY4)
   04916 Melanogenesis
    100978200 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100978200 (ADCY4)
   04927 Cortisol synthesis and secretion
    100978200 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100978200 (ADCY4)
   04270 Vascular smooth muscle contraction
    100978200 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100978200 (ADCY4)
   04971 Gastric acid secretion
    100978200 (ADCY4)
   04972 Pancreatic secretion
    100978200 (ADCY4)
   04976 Bile secretion
    100978200 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100978200 (ADCY4)
   04727 GABAergic synapse
    100978200 (ADCY4)
   04725 Cholinergic synapse
    100978200 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100978200 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100978200 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100978200 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100978200 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100978200 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100978200 (ADCY4)
   04714 Thermogenesis
    100978200 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100978200 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100978200 (ADCY4)
   05163 Human cytomegalovirus infection
    100978200 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100978200 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100978200 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100978200 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100978200 (ADCY4)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100978200 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52 DUF3180
Other DBs
NCBI-GeneID: 100978200
NCBI-ProteinID: XP_008959521
UniProt: A0A2R9BN50
Position
14
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAQEMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTR
YLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTTTILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAMALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgtgcg
ctcgcggcgctgctcgccgtggcctgggccagcggcagggagctgacctcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgggagcagcgactgcagcgctggacgcgtcccctgtccggcttggtatgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggcgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctgctggtcctcgggctgtatctt
gggccacagccggactcacggcctgcactgctgccgcagttggcagcaaacgcagtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccctgcactcacgccggcggctggacaccgagaag
aaacaccaggaacaccttctcttgtccatccttcctgcctacctggcccaagagatgaag
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagagagcactaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacacggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctctgggctgccactctcactgccagaccatgccatcaac
tgcgtgcgcatgggcctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagcgtactgtgtggagtcatcggg
ctgcagaagtggcagtacgacgtttggtcccatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggacgcaggcatggagcatcgggacccctaccttcgggagctaggg
gagcctacctatctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctgtcctcgcttgagggcctcaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggcgcagccaagccttttgcccacctgagccacggagacagccct
gtgtccacctccacccctctcccggagaagaccctggcttccttcagcacccagtggagc
ctggatcggagccgtaccccccggggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcgcagaaacagtggaagcagtcgaaggacttc
aaccccctgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggccatcacgtatagcatcaccttc
ctcctcttcctcctcatcctttttgtctgcttctcagaggacctgatgaggtgtgtcctg
aaaggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcaccaccaccatcctccttgtctttgccatggccattacc
agcctgttcttcttcccaacatcatcagactgccctttccaagctcccaatgtgtcctcc
atgatttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatac
tccatgcactgctgcacgctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcggcatcctgctccctcttcctgcac
tcccacgcctggctgtccgaatgcctcatcgtccgcctctatctgggccccttggactcc
aggcccggagtgctgaaggagcccaaactgatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagagggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctatgaatgcgtttgtgtcctcttcgcctcagtccca
gacttcaaggagttctactctgaatccaacatcaatcatgagggcctagagtgtctgagg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaagaccatcggcagcacctacatggcagccacaggcttaaatgccacc
tctggacaggatgcacaacaggatgctgaacggagctgcagccaccttggcactatggtg
gaatttgccatggccctggggtctaagctggacgtcatcaacaagcattcattcaacaac
ttccgcctgcgagtggggttgaaccatggacccgtagtagctggagttattggggcccag
aagccgcaatatgacatttggggcaacacagtgaacgtggccagccgcatggagagtaca
ggagtccttggcaaaatccaagtgactgaggagacagcatgggccctacagtccctgggc
tacacctgctacagccggggtgtcatcaaggtgaaaggcaaagggcagctctgcacctac
ttcctgaacacagacttgacacgaactggacctccttcagctaccctaggctga

KEGG   Pan paniscus (bonobo): 100984225
Entry
100984225         CDS       T02283                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps01522  Endocrine resistance
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04072  Phospholipase D signaling pathway
pps04114  Oocyte meiosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04727  GABAergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04976  Bile secretion
pps05032  Morphine addiction
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100984225 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100984225 (ADCY7)
   04371 Apelin signaling pathway
    100984225 (ADCY7)
   04020 Calcium signaling pathway
    100984225 (ADCY7)
   04072 Phospholipase D signaling pathway
    100984225 (ADCY7)
   04024 cAMP signaling pathway
    100984225 (ADCY7)
   04022 cGMP-PKG signaling pathway
    100984225 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100984225 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100984225 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100984225 (ADCY7)
   04062 Chemokine signaling pathway
    100984225 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    100984225 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    100984225 (ADCY7)
   04912 GnRH signaling pathway
    100984225 (ADCY7)
   04913 Ovarian steroidogenesis
    100984225 (ADCY7)
   04915 Estrogen signaling pathway
    100984225 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    100984225 (ADCY7)
   04921 Oxytocin signaling pathway
    100984225 (ADCY7)
   04926 Relaxin signaling pathway
    100984225 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    100984225 (ADCY7)
   04918 Thyroid hormone synthesis
    100984225 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    100984225 (ADCY7)
   04916 Melanogenesis
    100984225 (ADCY7)
   04925 Aldosterone synthesis and secretion
    100984225 (ADCY7)
   04927 Cortisol synthesis and secretion
    100984225 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100984225 (ADCY7)
   04270 Vascular smooth muscle contraction
    100984225 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    100984225 (ADCY7)
   04971 Gastric acid secretion
    100984225 (ADCY7)
   04972 Pancreatic secretion
    100984225 (ADCY7)
   04976 Bile secretion
    100984225 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    100984225 (ADCY7)
   04727 GABAergic synapse
    100984225 (ADCY7)
   04725 Cholinergic synapse
    100984225 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    100984225 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100984225 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    100984225 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    100984225 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100984225 (ADCY7)
   04714 Thermogenesis
    100984225 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100984225 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100984225 (ADCY7)
   05163 Human cytomegalovirus infection
    100984225 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    100984225 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100984225 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100984225 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100984225 (ADCY7)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100984225 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 100984225
NCBI-ProteinID: XP_003819859
UniProt: A0A2R8ZW57
Position
16
AA seq 1080 aa
MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIITFSQGDPS
RHQAILGMAFLALAVFAALSVLMYVECLLRRWLRALALLTWACLVALGYVLVFDAWTKAA
CAWEQVPFFLFIVFVVYTLLPFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVRVGLQL
LANAVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCQAIKQ
VREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETPVPNGRRPKSVPQRHRRTPDRSMSPKGRS
EDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACA
SLIFVCILLVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFSRCCPARGTLCTISER
VETQPLLRLTLAVLTIGSLLTVAVINLPLMPFQVPELPVGNETGLPAASSKTRALCEPLP
YYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCCGQGLGNLTEP
NSTTSGTPSCSRKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAH
IGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
RMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctcaacgagggcgaggagggccctgaccaagatgcg
ctctacgagaagtaccagctcaccagccagcatgggccgctgctgctcacgctcctgctg
gtggccgccactgcctgcgtggccctcatcatcatcaccttcagccagggggacccctcc
agacaccaggccattctgggcatggcgttcctggcgctggcggtgtttgcggccctctct
gtgctgatgtacgtcgagtgtctcctgcggcgctggctcagggccttggcgctgctcacc
tgggcctgcttggtggcgctgggctatgtgctggtgttcgacgcatggacaaaggcggcc
tgtgcatgggagcaggtgcccttcttcctgttcattgtcttcgtggtgtacacgctactg
cccttcagcatgcggggcgctgtcgccgttggggccgtctccactgcctcccacctcctg
gtgctcggttctttgatgggaggcttcacgacacccagtgtccgggtggggctgcagctg
ctggccaacgcagtcatcttcctgtgcgggaacctgacaggcgccttccacaagcaccaa
atgcaggatgcgtcccgggacctcttcacctacactgtgaagtgcatccagatccgccgg
aagctgcgcatcgagaagcgccagcaggagaacctgctgctgtcagtgcttccggcccac
atctccatgggcatgaagctggccatcatcgaacggctcaaggagcatggtgaccgtcgc
tgcatgcccgacaacaacttccacagcctctacgtcaagaggcaccagaacgtcagcatc
ctctatgcggacatcgtgggcttcacgcagctggccagcgactgttcccccaaggagttg
gtggtggtgctgaatgagctctttggcaagttcgaccagatcgccaaggccaacgagtgc
atgcgaatcaagatcctcggcgactgctactactgtgtatcgggcctgcccgtgtcgctg
cctacccacgcccgcaactgcgtgaagatggggctggacatgtgccaggccatcaagcag
gtgcgggaggccacgggcgtggacatcaacatgcgtgtgggcatacactcggggaatgtg
ctgtgcggggtcatcgggctgcgcaagtggcagtatgacgtgtggtcccacgacgtgtcc
ctggccaaccggatggaggcagccggagtacccggccgggtgcacatcacggaggcgacg
ctaaagcacctggacaaggcgtacgaggtggaggatgggcacgggcagcagcgggacccc
tacctcaaggagatgaacatccgcacctacctggtcatcgacccccggagccagcagcca
cccccgcccagccaacacctccccaggcccaagggggacgcggccctgaagatgcgggcg
tcagtgcgcatgacccggtacctcgagtcctggggggcggcacggccctttgcgcatctc
aaccaccgtgagagcgtgagcagtggtgagacccccgtccccaacgggcggaggcctaag
agcgttccccagcgccaccgccggaccccagacagaagcatgtcccccaaagggcggtcg
gaggatgactcgtacgatgacgagatgctgtcagccattgaggggctcagctccacgagg
ccctgctgctccaagtccgatgacttctacacctttgggtccatcttcctggagaagggc
tttgagcgcgagtaccgcctggcacccatcccccgggcccgccacgactttgcctgcgcc
agcctgatctttgtctgcatcctgctcgtccatgtcctgctcatgcccaggacggcggca
ctgggtgtgtcctttgggctggtggcctgtgtactggggctggtgctgggcctgtgcttt
gccaccaagttctcgaggtgctgcccagctcgggggacgctctgcactatctctgagagg
gtggagacacagcccctgctgaggctgaccctggccgtcctgaccatcggcagcctgctc
actgtggccgtcatcaacctgcccctgatgcctttccaagttccagagctgcctgttggc
aatgagacaggcctaccggccgcgagcagcaagacaagagccctgtgtgagcccctcccg
tactacacctgcagctgtgtcctgggcttcatcgcctgctcggtcttcctgaggatgagc
ctggagccaaaggttgtgctgctgacagtggccctggtggcctacctggtgctcttcaac
ctctccccatgctggcagtgggactgctgcggccaaggcctgggcaacctcaccgagccc
aacagcaccaccagtggcacccctagctgttcccggaaggacctgaagaccatgaccaat
ttctacctggtcctgttctacatcaccctgctcacactctccagacagattgactattac
tgccgcttggactgcctatggaagaagaagttcaagaaggagcacgaggagtttgagacc
atggagaacgtgaaccgccttcttctggagaacgtcctgccagcccacgtggctgcccac
tttatcggtgacaagttaaacgaggactggtaccatcagtcctatgactgcgtctgtgtc
atgtttgcctccgtgccggacttcaaagtgttctacacagagtgcgatgtcaacaaagaa
gggctggagtgcctacgcctgctcaatgagatcattgccgacttcgacgagctcctactg
aagcccaagttcagcggcgtggagaagatcaagaccatcggcagcacatacatggcagct
gcagggctcagcgtcgcctcagggcacgagaaccaggagctggagcggcagcatgcccac
attggtgtcatggtggagttcagcatcgccctgatgagtaagctggacggcatcaacagg
cactccttcaactccttccgcctccgcgtcggcataaaccatgggcctgtgattgctgga
gtgattggggcccgaaaacctcagtatgacatctggggaaacactgtcaacgtggccagc
cgaatggaaagcactggagaacttgggaaaatccaggttaccgaggagacctgcaccatc
ctccagggcctcgggtactcttgtgaatgccgtggcctgatcaacgtcaaaggcaaaggc
gagctgaggacttactttgtctgtacggacactgccaagtttcaggggctggggctgaac
tga

KEGG   Pan paniscus (bonobo): 100984585
Entry
100984585         CDS       T02283                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps01522  Endocrine resistance
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04072  Phospholipase D signaling pathway
pps04114  Oocyte meiosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04727  GABAergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04976  Bile secretion
pps05032  Morphine addiction
pps05142  Chagas disease
pps05146  Amoebiasis
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100984585 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100984585 (ADCY1)
   04371 Apelin signaling pathway
    100984585 (ADCY1)
   04020 Calcium signaling pathway
    100984585 (ADCY1)
   04072 Phospholipase D signaling pathway
    100984585 (ADCY1)
   04024 cAMP signaling pathway
    100984585 (ADCY1)
   04022 cGMP-PKG signaling pathway
    100984585 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100984585 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100984585 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100984585 (ADCY1)
   04062 Chemokine signaling pathway
    100984585 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    100984585 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    100984585 (ADCY1)
   04912 GnRH signaling pathway
    100984585 (ADCY1)
   04913 Ovarian steroidogenesis
    100984585 (ADCY1)
   04915 Estrogen signaling pathway
    100984585 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    100984585 (ADCY1)
   04921 Oxytocin signaling pathway
    100984585 (ADCY1)
   04926 Relaxin signaling pathway
    100984585 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    100984585 (ADCY1)
   04918 Thyroid hormone synthesis
    100984585 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    100984585 (ADCY1)
   04916 Melanogenesis
    100984585 (ADCY1)
   04925 Aldosterone synthesis and secretion
    100984585 (ADCY1)
   04927 Cortisol synthesis and secretion
    100984585 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100984585 (ADCY1)
   04270 Vascular smooth muscle contraction
    100984585 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    100984585 (ADCY1)
   04971 Gastric acid secretion
    100984585 (ADCY1)
   04972 Pancreatic secretion
    100984585 (ADCY1)
   04976 Bile secretion
    100984585 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100984585 (ADCY1)
   04727 GABAergic synapse
    100984585 (ADCY1)
   04725 Cholinergic synapse
    100984585 (ADCY1)
   04720 Long-term potentiation
    100984585 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    100984585 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100984585 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    100984585 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    100984585 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100984585 (ADCY1)
   04714 Thermogenesis
    100984585 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100984585 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100984585 (ADCY1)
   05163 Human cytomegalovirus infection
    100984585 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100984585 (ADCY1)
   05142 Chagas disease
    100984585 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    100984585 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100984585 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100984585 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100984585 (ADCY1)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100984585 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 100984585
NCBI-ProteinID: XP_008967038
Position
7
AA seq 894 aa
MYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLK
PPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCR
RIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVL
CGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSF
LKTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFS
NVMTCEDDDKRRALRTASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADL
NFFTLKYKHVEREQKYHQLQDEYFTSAVVLTLILAALFGLVYLLIFPQSVVVLLLLVFCI
CFLVACVLYLHITRVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSKPNS
SLVVLSSGGQRTALPTLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYIL
VLELSGYTRTGGGAVSGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEERED
MEKVKLDNRRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELD
GNNMGVECLRLLNEIIADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSIS
SHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNV
ASRMDSTGVQGRIQVTEEVHRLLRRCPYHFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQI
RSLGLDRKMCPFGRAGLQGRRPPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgtatggggtctttgtgcggattctgactgagcgttcgcagaggaaggcgttcctgcag
gcccggagctgcattgaggaccgactgaggctggaggatgagaacgagaagcaggagcgg
ctcctcatgagcctcctgccccggaacgttgccatggagatgaaggaggacttcctgaag
ccccctgagaggattttccacaagatttacatccagaggcacgacaatgtgagcatcctg
tttgctgacatcgtgggtttcacgggcttggcatcccagtgcacagcccaggagctggtg
aaactcctcaatgagctcttcggcaagttcgatgaattagccacggagaaccactgtcgc
cgcatcaagattctcggggactgctactactgtgtgtcgggcctcacccagcccaagact
gaccatgcccactgctgtgtggagatgggactcgatatgattgataccatcacatctgtg
gctgaagccaccgaggtggatctgaacatgcgtgtgggtctgcacacgggcagggtcctc
tgtggtgtcctgggcttgcgcaagtggcagtacgacgtgtggtccaatgatgtgaccttg
gccaatgtcatggaagccgctggcctgccagggaaggttcatatcacaaagacgacccta
gcgtgcttgaatggggactacgaggtagaaccaggttacggacatgagaggaacagtttc
ttgaaaactcataacatcgaaaccttttttattgtgccatcccatcgccgaaagatattt
ccaggcctgattctctcagatataaaaccggccaaaaggatgaagttcaagactgtctgc
tacctgctggtgcagctcatgcactgccggaaaatgttcaaggccgagatccccttctcc
aatgtcatgacctgcgaggacgatgacaagcggagggcattaagaacagcctcggaaaaa
ctcagaaaccgctcatctttttctaccaacgttgtctacaccaccccgggcactcgcgtc
aacaggtacatcagccgcctcttagaagcccgccagacagagctggagatggcagacctg
aacttctttaccctgaagtacaaacatgtcgaacgggagcaaaagtaccaccagcttcag
gacgagtatttcaccagcgccgttgtcctcaccctcatcctggctgccttatttggcctt
gtctaccttctaatattcccacagagtgtggtcgtcctgctcctgctagtattctgcatc
tgcttcctggtggcctgtgtcctgtacctgcacatcacccgggtccagtgttttccaggg
tgcctgacgattcagattcgcactgtcctgtgtattttcatagtggtcttaatctactca
gtagcccaaggttgtgtggtgggctgcctgccttgggcctggagctccaagcccaacagt
tccctggtggtcctttcgtctgggggccagcgcacagccctgcccaccctgccctgcgag
tctacacaccatgccctgctctgctgcctagtgggcaccctcccgctagccatatttttc
cgggtgtcctccttgccaaaaatgatcctgctctccgggctcaccacgtcctacatcctc
gttctggagctcagcggatacaccaggactgggggtggtgccgtctccgggcgcagctac
gagccaattgtggccatcctgctcttctcctgtgcgctggccctgcatgccaggcaggtg
gacatcaggctgaggctggactacctctgggccgcacaggcagaggaggagcgagaggac
atggagaaggtgaagctggacaacaggcgcatcctcttcaacctcctgccggcccacgtc
gcccagcacttcctcatgtccaaccctcggaacatggacctctactaccagtcctactcc
caggtgggcgtcatgtttgcctccatccccaacttcaatgacttctacatcgagctggac
ggtaacaacatgggggtggagtgtctgcggcttctcaacgagatcatcgccgactttgac
gagctcatggaaaaagacttttacaaggacatagagaagatcaagaccatcgggagcacc
tacatggccgctgtggggctagcgcccacctcggggaccaaggctaagaagtccatctcc
tcccacctgagcacgctggcggactttgccattgagatgtttgacgttctggatgaaatc
aactaccagtcttacaacgacttcgtcctccgagttggcatcaatgttggccctgtggtg
gctggagtgattggcgctcgcaggccccagtacgacatctggggaaacacagtcaacgtg
gccagtcggatggatagcacaggggtccagggcagaatccaggtgactgaggaagtccac
cggctgctgagaaggtgcccctaccactttgtgtgccgaggcaaagtcagtgtcaagggc
aaaggcgagatgttgacatactttctagaaggcaggactgatggaaacggctcccaaatc
aggtccctgggcttggatcggaaaatgtgtccatttgggagagctggccttcagggcaga
cgtcccccggtgtgccccatgcctggcgtctcagtcagggctgggctccctccacactcc
ccaggccagtacctgccctctgcagcagctgggaaggaggcttag

KEGG   Pan paniscus (bonobo): 100992014
Entry
100992014         CDS       T02283                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps01522  Endocrine resistance
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04072  Phospholipase D signaling pathway
pps04114  Oocyte meiosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04727  GABAergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04976  Bile secretion
pps05032  Morphine addiction
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100992014 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100992014 (ADCY2)
   04371 Apelin signaling pathway
    100992014 (ADCY2)
   04020 Calcium signaling pathway
    100992014 (ADCY2)
   04072 Phospholipase D signaling pathway
    100992014 (ADCY2)
   04024 cAMP signaling pathway
    100992014 (ADCY2)
   04022 cGMP-PKG signaling pathway
    100992014 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100992014 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100992014 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100992014 (ADCY2)
   04062 Chemokine signaling pathway
    100992014 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    100992014 (ADCY2)
   04922 Glucagon signaling pathway
    100992014 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    100992014 (ADCY2)
   04912 GnRH signaling pathway
    100992014 (ADCY2)
   04913 Ovarian steroidogenesis
    100992014 (ADCY2)
   04915 Estrogen signaling pathway
    100992014 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    100992014 (ADCY2)
   04921 Oxytocin signaling pathway
    100992014 (ADCY2)
   04926 Relaxin signaling pathway
    100992014 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    100992014 (ADCY2)
   04918 Thyroid hormone synthesis
    100992014 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    100992014 (ADCY2)
   04916 Melanogenesis
    100992014 (ADCY2)
   04925 Aldosterone synthesis and secretion
    100992014 (ADCY2)
   04927 Cortisol synthesis and secretion
    100992014 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100992014 (ADCY2)
   04270 Vascular smooth muscle contraction
    100992014 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    100992014 (ADCY2)
   04971 Gastric acid secretion
    100992014 (ADCY2)
   04972 Pancreatic secretion
    100992014 (ADCY2)
   04976 Bile secretion
    100992014 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100992014 (ADCY2)
   04727 GABAergic synapse
    100992014 (ADCY2)
   04725 Cholinergic synapse
    100992014 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    100992014 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100992014 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    100992014 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    100992014 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100992014 (ADCY2)
   04714 Thermogenesis
    100992014 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100992014 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100992014 (ADCY2)
   05163 Human cytomegalovirus infection
    100992014 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    100992014 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100992014 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100992014 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100992014 (ADCY2)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100992014 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 100992014
NCBI-ProteinID: XP_003809276
UniProt: A0A2R9B9K9
Position
5
AA seq 1049 aa
MEQPSGPALWDARWWHEKGGLLCLGFLGEVEDHVAFLITVPTALAIFFAIFILVCIESVF
KKLLRLFSLVIWICLVAMGYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIAS
VLTSSSHTIVLSVCLSATPGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQD
TCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLY
VKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYY
CVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQ
YDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYF
VINPKGERRSPQHLFRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGK
ISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLL
FYNKVLEKEYRATALPAFKYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFI
LFVCFAGQLLQCSKKASPLLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFFLS
DSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELK
MLIMMVALVGYNTILLHTHAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGR
QNEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQS
YDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIG
STYMAATGLSTVPSQEHSQEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGIN
HGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGI
INVKGKGDLKTYFVNTEMSRSLSQSNVAS
NT seq 3150 nt   +upstreamnt  +downstreamnt
atggaacagccctctgggcctgccctctgggatgctcgctggtggcacgaaaagggaggg
ctcttgtgccttggattccttggggaagttgaagaccatgtggcgtttctaataacagtt
ccaactgccctggcgattttctttgcgatatttatcctggtctgcattgagtctgtgttt
aagaagctgctgcgcctcttctcgttggtgatatggatatgccttgttgccatgggatac
ctgttcatgtgttttggaggcaccgtctctccctgggaccaggtatcgttcttcctcttc
atcatcttcgtggtgtacaccatgctgcccttcaacatgcgagacgccatcattgccagc
gtcctcacctcctcctcccacaccatcgtgcttagcgtctgcctgtctgcaacaccggga
ggcaaggagcacctggtctggcagatcctggccaatgtgatcattttcatctgtgggaac
ctggcgggagcctaccataagcacctcatggaactcgctcttcagcaaacatatcaggac
acctgtaattgcatcaagtcccggatcaagttggaatttgaaaaacgtcaacaggagcgg
cttctgctctccctgctgccggcccacatcgccatggagatgaaagcggagatcatccag
aggctgcagggccccaaggcgggccagatggagaacacaaataacttccacaacctgtat
gtgaagcggcataccaacgtgagcatcttatacgctgacatcgttggctttacccggctg
gcaagtgactgctccccaggagaactagtccacatgctgaatgagctctttggaaagttt
gatcaaattgcaaaggagaatgaatgcatgagaattaaaattttaggagactgctactac
tgtgtatctggactccctatatctctccctaaccatgccaagaactgtgtgaaaatgggg
ctggatatgtgtgaagccataaagaaagtgagggatgctactggagttgatatcaacatg
cgcgtgggcgtgcattctgggaatgtcctgtgcggcgtgattggtctgcagaagtggcaa
tatgatgtgtggtcacatgatgtgaccttggccaaccacatggaagctggaggggtccct
ggacgtgttcacatttcttctgtcaccctggagcacttgaatggcgcttataaagtggag
gagggagatggtgacattagggacccatatttaaaacagcacctggtgaaaacctacttt
gtgatcaaccccaagggagaacgacggagcccccagcatctcttcagacctcgccacacc
cttgatggagccaaaatgagggcctcggtccgcatgacccggtacttggagtcctggggg
gcagccaagccctttgcacacctacatcacagggacagcatgaccacagagaacggcaag
atcagcaccacggatgtacccatgggtcagcataattttcaaaatcgcaccttaagaacc
aagtcacaaaagaagagatttgaagaagaattgaatgaaaggatgattcaagcaattgat
gggattaatgcacagaagcaatggctcaagtctgaagacattcagagaatctcactgctt
ttctataacaaagtactagaaaaagagtaccgggccacggcactgccagcgttcaaatat
tatgtgacttgtgcctgtctcatattcttctgcatcttcattgtgcagattctcgtgctg
ccaaaaacgtccgtcctgggcatctcctttggggctgcgtttctcttgctggccttcatc
ctcttcgtctgctttgctggacagcttctgcaatgcagcaaaaaagcctctcccctgctc
atgtggcttttgaagtcctcgggcatcattgccaaccgcccctggccacggatctctctc
acgatcatcaccacagccatcatattaatgatggctgtgttcaacatgtttttcctgagt
gactcagaggaaacaatccctccaactgccaacacaacaaacacaagcttttcagcctca
aataatcaggtggcgattctgcgtgcgcaaaatttatttttcctcccgtactttatctac
agctgcattctgggactgatatcctgttccgtgttcctgcgggtaaactatgagctgaag
atgttgatcatgatggtggccttggtgggctacaacaccatcctactccacacccatgcc
cacgtcctgggcgactacagccaggtcttatttgagagaccaggcatttggaaagacctg
aagaccatgggctctgtgtctctctctatattcttcatcacactgcttgttctgggtaga
cagaatgaatattactgtaggttagacttcttatggaagaacaaattcaaaaaagagcgg
gaggagatagagaccatggagaacctgaaccgcgtgctgctggagaacgtgcttcccgcg
cacgtggctgagcacttcctggccaggagcctgaagaatgaggagctataccaccagtcc
tatgactgcgtctgcgtcatgtttgcctccattccggatttcaaagaattttatacagaa
tctgacgtgaacaaggagggcttggaatgccttcggctcctgaacgagatcatcgctgac
tttgatgatcttctttccaagccaaaattcagtggagttgaaaagattaagaccattggc
agcacatacatggcagcaacaggtctgagcactgtgcccagccaggagcactcccaggag
cccgagcggcagtacatgcacattggcaccatggtggagtttgcttttgccctggtaggg
aagctggatgccatcaacaagcactccttcaacgacttcaaattgcgagtgggtattaac
catggacctgtgatagctggtgtgattggagctcagaagccacaatatgatatctggggc
aacactgtcaatgtggccagtaggatggacagcaccggagtcctggacaaaatacaggtt
accgaggagacgagcctcgtcctgcagaccctcggatacacgtgcacctgtcgaggaata
atcaacgtgaaaggaaagggggacctgaagacgtactttgtaaacacagaaatgtcaagg
tccctttcccagagcaacgtggcatcctga

KEGG   Pan paniscus (bonobo): 100994715
Entry
100994715         CDS       T02283                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps01522  Endocrine resistance
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04072  Phospholipase D signaling pathway
pps04114  Oocyte meiosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04727  GABAergic synapse
pps04742  Taste transduction
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04976  Bile secretion
pps05032  Morphine addiction
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100994715 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100994715 (ADCY8)
   04371 Apelin signaling pathway
    100994715 (ADCY8)
   04020 Calcium signaling pathway
    100994715 (ADCY8)
   04072 Phospholipase D signaling pathway
    100994715 (ADCY8)
   04024 cAMP signaling pathway
    100994715 (ADCY8)
   04022 cGMP-PKG signaling pathway
    100994715 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100994715 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100994715 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100994715 (ADCY8)
   04062 Chemokine signaling pathway
    100994715 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    100994715 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    100994715 (ADCY8)
   04912 GnRH signaling pathway
    100994715 (ADCY8)
   04913 Ovarian steroidogenesis
    100994715 (ADCY8)
   04915 Estrogen signaling pathway
    100994715 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    100994715 (ADCY8)
   04921 Oxytocin signaling pathway
    100994715 (ADCY8)
   04926 Relaxin signaling pathway
    100994715 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    100994715 (ADCY8)
   04918 Thyroid hormone synthesis
    100994715 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    100994715 (ADCY8)
   04916 Melanogenesis
    100994715 (ADCY8)
   04925 Aldosterone synthesis and secretion
    100994715 (ADCY8)
   04927 Cortisol synthesis and secretion
    100994715 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100994715 (ADCY8)
   04270 Vascular smooth muscle contraction
    100994715 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    100994715 (ADCY8)
   04971 Gastric acid secretion
    100994715 (ADCY8)
   04972 Pancreatic secretion
    100994715 (ADCY8)
   04976 Bile secretion
    100994715 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    100994715 (ADCY8)
   04727 GABAergic synapse
    100994715 (ADCY8)
   04725 Cholinergic synapse
    100994715 (ADCY8)
   04720 Long-term potentiation
    100994715 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    100994715 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    100994715 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    100994715 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    100994715 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    100994715 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100994715 (ADCY8)
   04714 Thermogenesis
    100994715 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100994715 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100994715 (ADCY8)
   05163 Human cytomegalovirus infection
    100994715 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    100994715 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100994715 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100994715 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100994715 (ADCY8)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100994715 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 100994715
NCBI-ProteinID: XP_003830145
UniProt: A0A2R9BI25
Position
8
AA seq 1251 aa
MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGS
GSGGSGKASDPAGGGPNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLDGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
IVKESVSSSDQRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINE
TYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKEA
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTESGAQAEGTDKSDLP
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgccttacaggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcaggagcgcctcccggccgcagcggctgctgtggcagacg
gcggtgcgacacatcacggagcagcgcttcattcacgggcaccggggaggcagcggcagc
gggagtggaggctcgggcaaagcctcggaccctgcgggcggcggccccaaccaccacgcg
ccgcagctgtcaggcgactcggcgctgcccctctactcgctgggcccaggagagcgagcg
cacagcacctgcggcaccaaagtcttcccggaacgcagcgggagcggcagtgccagcggc
agcggaggcgggggcgacctgggcttcctgcaccttgactgtgcccctagcaactcggat
ttctttcttaatgggggctatagctaccgaggggtcattttccccaccctgcgcaactcc
ttcaaatctcgggatttggaacgcctctaccagcgctatttcttgggccaaaggcgcaaa
tcggaagtggtgatgaacgtgctggacgtgctgaccaaactcactctcttggtcctacac
ttgagcctggcctcggcccccatggacccgctcaagggcatcctgctgggcttcttcacc
ggcattgaggtagtgatctgcgccctggtggtggtcaggaaggacaccacctcccacacg
tacctgcagtacagcggcgtggtcacctgggtggccatgaccacccagatcctggcagca
ggcctcggctacgggctcctgggcgacggcataggctacgtgctcttcacgctcttcgcc
acctacagtatgctgccgctgccgctcacctgggccatcctggccggcctgggcacctcg
ctgctgcaggtcatcctccaagtggtcataccccggctggcggtcatttccatcaaccag
gttgtggcccaggcagtgttattcatgtgtatgaacacagctggaatcttcatcagttac
ctgtcagaccgggcccagcgccaagctttcctggagactcggaggtgtgtggaggccagg
ctgcgcctggagacagagaaccaaagacaggagcggctcgtgctttctgtgctcccccgg
tttgttgtcctggaaatgatcaacgacatgaccaatgtggaagatgagcacctgcagcac
cagttccatcggatctacatccatcgctatgagaacgtcagtattctttttgcagatgtt
aaaggatttaccaacctctccacgaccttgtctgctcaggagctggtcaggatgctcaac
gagctctttgccagatttgatcgactggcccatgagcatcactgccttcgtattaaaatc
ctgggggactgctactactgcgtgtctggacttcctgagccccgccaggaccatgcccac
tgctgtgttgaaatgggtctcagcatgatcaaaaccatcaggtatgtgcggtcaaggaca
aaacatgatgttgacatgaggattggaatccactcaggctcggtgctgtgcggtgttttg
ggactcaggaagtggcagtttgatgtctggtcttgggatgtggatattgcaaacaaactc
gaatctggaggaatccccgggaggattcacatttccaaagccacgctggactgtctcgac
ggtgactataacgtggaagagggtcatggtaaagagaggaatgaattcctgaggaagcat
aatatcgaaacttacttaattaagcagcctgaggacagtctgctgtccttgcctgaagac
atcgtcaaggagtcagtgagctcctcagaccagagaaacagtggggccacattcactgaa
ggatcctggagccctgaactgccctttgataatatcgtggggaaacagaatactctggct
gccctaacaagaaattcaataaatctgcttccaaaccatcttgcacaagctttgcatgtc
cagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggc
gataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctg
gagcacaagtattctcaaatgagggatgaagtgttcaagtcaaacttggtctgtgcattt
atcgttcttctatttatcacggcaatacaaagtttgcttccttcttcaagagtgatgcca
atgaccatccagttctccattctgattatgctgcactcggctctggtcctcatcaccaca
gcagaggattataaatgtttgcccctcatcctccggaaaacttgctgttggattaatgag
acctatttggcccggaacgtcatcatctttgcatccattttgattaatttcctgggtgcc
atcttaaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttc
aattcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttcacaggg
gtgttggccatggtgacctgtgcagttttcctccggctgaactctgtcctgaagctggca
gtgctgctgatcatgattgccatctatgccctgctcactgagaccgtctacgcaggcctc
tttctgcgttatgacaacctcaaccacagtggagaagatttcctggggaccaaggaggca
tcactgctactgatggccatgttcctcctggctgtgttctaccatggacagcagctggag
tacacagcccgcctggacttcctttggcgagtacaggccaaagaggagatcaatgagatg
aaggagctgagggaacacaatgagaacatgctccggaatatcttacccagccatgtggcc
cgccatttcctagaaaaggaccgcgacaatgaggagctgtattctcaatcctatgatgct
gttggggtgatgtttgcctccatcccaggatttgcggacttttactctcagactgaaatg
aataaccagggagtggaatgcctgcgcttgctcaatgagatcattgctgacttcgatgag
ttgcttggtgaagaccgatttcaagacattgaaaagattaagaccattggcagcacctac
atggccgtgtcaggcctgtcacctgaaaaacagcaatgtgaagacaagtggggacatttg
tgtgctctggctgacttctcactcgccctgacagaaagcatacaggagatcaacaagcat
tcattcaacaattttgaactccggattggcatcagccatggctcagtggtagctggcgtt
atcggcgctaagaaaccacagtatgacatttggggcaaaactgtgaacctggcaagccga
atggacagcacgggggttagtggccggatccaagtcccagaggagacctatctcatcctg
aaggaccagggctttgcctttgattaccgaggggagatctatgtgaagggcatcagtgaa
caggaaggaaaaatcaaaacgtactttctcctgggaagagtccaacccaacccattcatc
ttgcccccaagaagactgcctgggcagtactccctggccgcggttgtcctgggacttgtc
cagtccctcaataggcaaaggcagaagcagctactcaatgagaacaacaacacaggaatc
atcaagggtcattacaaccggcggactttgttgtcacccagcgggacggagtctggagcc
caggctgaaggcaccgacaaatctgatttgccataa

KEGG   Pan paniscus (bonobo): 100995134
Entry
100995134         CDS       T02283                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps01522  Endocrine resistance
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04072  Phospholipase D signaling pathway
pps04114  Oocyte meiosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04727  GABAergic synapse
pps04740  Olfactory transduction
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04962  Vasopressin-regulated water reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04976  Bile secretion
pps05032  Morphine addiction
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100995134 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100995134 (ADCY3)
   04371 Apelin signaling pathway
    100995134 (ADCY3)
   04020 Calcium signaling pathway
    100995134 (ADCY3)
   04072 Phospholipase D signaling pathway
    100995134 (ADCY3)
   04024 cAMP signaling pathway
    100995134 (ADCY3)
   04022 cGMP-PKG signaling pathway
    100995134 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100995134 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100995134 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100995134 (ADCY3)
   04062 Chemokine signaling pathway
    100995134 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    100995134 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    100995134 (ADCY3)
   04912 GnRH signaling pathway
    100995134 (ADCY3)
   04913 Ovarian steroidogenesis
    100995134 (ADCY3)
   04915 Estrogen signaling pathway
    100995134 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    100995134 (ADCY3)
   04921 Oxytocin signaling pathway
    100995134 (ADCY3)
   04926 Relaxin signaling pathway
    100995134 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    100995134 (ADCY3)
   04918 Thyroid hormone synthesis
    100995134 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    100995134 (ADCY3)
   04916 Melanogenesis
    100995134 (ADCY3)
   04925 Aldosterone synthesis and secretion
    100995134 (ADCY3)
   04927 Cortisol synthesis and secretion
    100995134 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100995134 (ADCY3)
   04270 Vascular smooth muscle contraction
    100995134 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    100995134 (ADCY3)
   04971 Gastric acid secretion
    100995134 (ADCY3)
   04972 Pancreatic secretion
    100995134 (ADCY3)
   04976 Bile secretion
    100995134 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100995134 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100995134 (ADCY3)
   04727 GABAergic synapse
    100995134 (ADCY3)
   04725 Cholinergic synapse
    100995134 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    100995134 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    100995134 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    100995134 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    100995134 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    100995134 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100995134 (ADCY3)
   04714 Thermogenesis
    100995134 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100995134 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100995134 (ADCY3)
   05163 Human cytomegalovirus infection
    100995134 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    100995134 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100995134 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100995134 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100995134 (ADCY3)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100995134 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA OPA3 RAP1 Peptidase_S49_N
Other DBs
NCBI-GeneID: 100995134
NCBI-ProteinID: XP_008950647
UniProt: A0A2R9BLU9
Position
2A
AA seq 1145 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGIGLVLDII
LFVLCKKGLLPDRVTRRVVPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPGNATAGMETEGSCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDSRLPLVPSK
YSMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcccgaatactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggctcctgcctgtgcctgcctcgcttcatgcggctgactttcgtgccggag
tccttggagaacctctaccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgcagccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctggctcccctcgccgtggctggaattggactggtgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccgcagagtggtgccc
tacgtgctgtggctgctcataaccgcccagatcttctcctacctgggcctgaacttcgcg
cgtgcccacgcggctagtgacacggtgggctggcaggtcttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtgatcatctccgtggtctcctgtgtggtg
cacacgttggtcctgggggtcaccgtggcccagcagcagcaggaggagctcaaggggatg
cagctgctgcgggagatcctggccaacgtcttcctctacctgtgcgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaagacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgtcacgagaacgtcagcatc
ctctttgccgacattgtgggctttactcagctgtcttctgcctgcagtgcccaggagctt
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgaggattaagatcctgggcgactgctactactgcatctgcggcttgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctggccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtcgactgatgtcact
gtagccaacaagatggaggccggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggagccaggcgatgggggcagccgctgtgat
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccagaatggcctcaatggctcggccctgcccaatggagcaccagcttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaacgggagtgcccacagc
agcgggtccacgtcggagaagcccgaggagcaggatgcccaggccgacaacccctcattc
cccaacccacgccggaggctgcgcctgcaggacctggctgaccgagtggtggatgcctct
gaagatgagcacgagctcaaccagctgctcaacgaggccctgcttgagcgagagtccgcc
caagtagtaaagaagagaaacaccttcctcttgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggccctggtcgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcatggtgggggagattctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcaacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacgggacccggcaatgcaacggcaggg
atggagacggagggcagctgcctggagaaccccaagtattacaactatgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgctcgtcgcaggcgccgtggccaccatcaacctctatgcctggcgccccgtctttgat
gaatacgaccacaagcgttttcgggagcacgacttacctatggtggccttagagcagatg
caaggattcaaccctgggctcaatggcactgacagcaggctgcccctggtgccttccaag
tactctatgacggtgatggtgttcctcatgatgctcagcttctactacttctcccgccac
gtagaaaagctggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtatagccagacgtat
gatgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggag
agcatcaacaatggtggtattgagtgtctgcgtttcctcaatgaaatcatctcggatttt
gactctctcctggacaatcccaagttccgggtgatcaccaagatcaaaaccattggcagc
acgtatatggcggcttcaggagtcacccccgatgtcaacaccaatggctttgccagctcc
aacaaggaagacaagtccgagagagagcgctggcagcacctggctgacctggccgacttc
gcgctggccatgaaggatacgctcaccaacatcaacaaccagtccttcaataacttcatg
ctgcgcataggcatgaacaaaggcggggttctggctggggtcatcggagcccggaaacca
cactacgacatctggggcaatacagtcaatgtagccagcaggatggagtccacgggggtc
atgggcaacattcaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgc
tttgtgaggcgaggccccatctttgtgaaggggaagggggagctgctgaccttcttcttg
aaggggcgggataagctagccaccttccccaatggcccctctgtcacactgccccaccag
gtggtggacaactcctga

DBGET integrated database retrieval system