KEGG   Pan paniscus (bonobo): 100972510
Entry
100972510         CDS       T02283                                 

Gene name
CACNA1I
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04020  Calcium signaling pathway
pps04713  Circadian entrainment
pps04925  Aldosterone synthesis and secretion
pps04927  Cortisol synthesis and secretion
pps04929  GnRH secretion
pps04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100972510 (CACNA1I)
   04020 Calcium signaling pathway
    100972510 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100972510 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    100972510 (CACNA1I)
   04927 Cortisol synthesis and secretion
    100972510 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100972510 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100972510 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100972510 (CACNA1I)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100972510 (CACNA1I)
SSDB
Motif
Pfam: Ion_trans PKD_channel
Other DBs
NCBI-GeneID: 100972510
NCBI-ProteinID: XP_014198783
Position
22
AA seq 1934 aa
MLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCY
LGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDT
LPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQGDVALPPYYQPEEDDEM
PFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNV
CRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVG
SFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSSSTVASYAEPGDCYEEIFQYVCHI
LRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPHAKEPRHYQLCPQHSPLDATPHTLVQ
PIPATLASDPASCPCCQHEAGRRPSGLGSTDSGQEGSGSGSSAGGEDEADGDGARSSEDG
ASSELGKEEEEEEQADGAVWLCGDVWRETRAKLRGIVDSKYFNRGIMMAILVNTVSMGIE
HHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIV
GQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILG
MHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASL
YFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSSSNIEEFDKLQEGLDSSGD
PKLCPIPMTPNGHLDPSLPLVGHLGPAGAAGPPPRLSLQPDPMLVALGSRKSSVMSLGRM
SYDQRSLSSSRSSYYGPWGRSAAWASRRSSWNSLKHKPPSAEHESLLSAERGGGARVCEV
ATDEGPPRAAPLHAPHAHHVHHGPHLAHRHRHHRRTLSLDNRDSVDLAELVPAVGAHPRA
AWRAAGPAPGHEDCNGRMPSIAKDVFTKMGDRGDRGEDEEEIDYTLCFRVRKMIDVYKPD
WCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTE
RIFLTVSNYIFTAIFVGEMTLKVAXXGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSLA
SAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIF
GILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASKD
GWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQH
QEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCHTRLLIHSMCTSHYLDIFITFIICLN
VVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVL
LSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVG
NLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNW
NGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEA
QEDAEMDAELELEMAHGLGPGPRLPTGSPGRPPGRGPGGAGGGGDTEGGLCRRCYSPAQE
NLWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSPAGCKKCHHDKQEVQLAETEAFSLN
SDRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVGDLGECFFPLSSTAVSPDPE
NFLCEMEEIPFNPVRSWLKHDSSQAPPSPFSPDASSPLLPMPAEFFHPAVSASQKGPEKG
TGTGTLPKIALQGSWASLRSPRVNCTLLRQATGSDTSLDASPSSSAGSLQTTLEDSLTLS
DKLEPGDAASKRKR
NT seq 5805 nt   +upstreamnt  +downstreamnt
atgctggtgatcctgctgaactgcgtgacacttggcatgtaccagccgtgcgacgacatg
gactgcctgtccgaccgctgcaagatcctgcaggtctttgatgacttcatctttatcttc
tttgccatggagatggtgctcaagatggtggccctggggatttttggcaagaagtgctac
ctcggggacacatggaaccgcctggatttcttcatcgtcatggcagggatggtcgagtac
tccctggaccttcagaacatcaacctgtcagccatccgcaccgtgcgcgtcctgaggccc
ctcaaagccatcaaccgcgtgcccagtatgcggatcctggtgaacctgctcctggacaca
ctgcccatgctggggaatgtcctgctgctctgcttctttgtcttcttcatctttggcatc
ataggcgtgcagctctgggcgggcctgctgcgtaaccgctgcttcctggaggagaacttc
accatacaaggggatgtggccttgcccccatactaccagccggaggaggatgatgagatg
cccttcatctgctccctgtcgggcgacaatgggataatgggctgccatgagatccccccg
ctcaaggagcagggccgtgagtgctgcctgtccaaggacgacgtctacgactttggggcg
gggcgccaggacctcaatgccagcggcctctgtgtcaactggaaccgttactacaatgtg
tgccgcacgggcagcgccaacccccacaagggtgccatcaactttgacaacatcggttat
gcttggattgtcatcttccaggtgatcactctggaaggctgggtggagatcatgtactac
gtgatggatgctcactccttctacaacttcatctacttcatcctgcttatcatagtgggc
tccttcttcatgatcaacctgtgcctcgttgtcatagcgacccagttctcggagaccaag
caacgggagcaccggctgatgctggagcagcggcagcgctacctgtcctccagcacggtg
gccagctacgccgagcctggcgactgctatgaggagatcttccagtatgtctgccacatc
ctgcgcaaggccaagcgccgcgccctgggcctctaccaggccctgcagagccggcgccag
gccctgggcccggaggccccggcccccgccaaacctgggccccacgccaaggagccccgg
cactaccagctgtgcccgcaacatagccccctggatgcgacgccccacaccctggtgcag
cccatccccgccacgctggcctccgatcccgccagctgcccttgctgccagcatgaggcc
ggccggcggccctcgggcctgggcagcaccgactcgggccaggaaggctcgggctccggg
agctccgctggtggcgaggacgaggcggatggggacggggcccggagcagcgaggacgga
gcctcctcagaactggggaaggaggaggaggaggaggagcaggcggatggggcggtctgg
ctgtgcggggatgtgtggcgggagacgcgagccaagctgcgcggcatcgtggacagcaag
tacttcaaccggggcatcatgatggccatcctggtcaacactgtcagcatgggcatcgag
caccatgagcagcctgaggagctgaccaacatcctggagatctgcaatgtggtcttcacc
agcatgtttgccttggagatgatcctgaagctggctgcgtttgggctcttcgactacctg
cgtaacccctacaacatcttcgacagcatcattgtcatcatcagcatctgggagatcgtg
gggcaggcggacggtgggctgtcggtgctgcggaccttccggctgctgcgcgtgctgaaa
ctggtgcgcttcatgcctgccctgcggcgccagctcgtggtgctcatgaagaccatggac
aacgtggccaccttctgcatgctgctcatgctcttcatcttcatcttcagcatccttggg
atgcatatttttggctgcaagttcagcctccgcacggacactggagacacggtgcctgac
aggaagaacttcgactccttgctgtgggccatcgtcactgtgttccagatcctcacccag
gaggactggaacgtcgttctctacaatggcatggcctccacttctccctgggcctccctc
tactttgtcgccctcatgaccttcggcaactatgtgctcttcaacctgctggtggccatc
ctggtggagggcttccaggcggagggtgacgccaatcgctcctactcggacgaggaccag
agctcatccaacatagaggagtttgataagctccaggaaggcctggacagcagcggagat
cccaagctctgcccaatccccatgacccccaatgggcacctggaccccagtctcccactg
gttgggcacctaggtcctgctggggctgcgggacctcccccccgactctcactgcagccg
gaccccatgctggtggccctgggctcccgaaagagcagcgtcatgtctctagggaggatg
agctatgaccagcgctccctgtccagctcccggagctcctactatgggccatggggccgc
agcgcggcctgggctagccgtcgctccagctggaacagcctcaagcacaagccgccgtca
gcggagcatgagtccctgctctctgcggagcgcggcggcggcgcccgggtctgcgaggtt
gccacggacgaggggccgccgcgggccgcacccctgcacgccccgcacgcccaccacgtt
catcacgggccccatctggcgcaccgccaccgccaccaccgccggacgctgtccctcgac
aacagggactcggtggacctggccgagctggtgcccgcggtgggcgcccacccccgggct
gcctggagggcggcaggcccggcccccgggcatgaggactgcaatggcaggatgcccagc
atcgccaaggacgtcttcaccaagatgggcgaccgcggggatcgcggggaggatgaggag
gaaatcgactacaccctgtgcttccgcgtccgcaagatgatcgacgtctataagcccgac
tggtgcgaggtccgcgaagactggtctgtctacctcttctctcccgagaacaggttccgg
gtcctgtgtcagaccattattgcccacaagctcttcgactacgtcgtcctggccttcatc
tttctcaactgcatcaccatcgccctggagcggcctcagatcgaggccggcagcaccgaa
cgcatctttctcaccgtgtccaactacatcttcacggccatcttcgtgggcgagatgaca
ttgaaggtagcnnnnnnnggcctgtacttcggcgagcaggcgtacctacgcagcagctgg
aacgtgctggatggctttcttgtcttcgtgtccatcatcgacatcgtggtgtccctggcc
tcagccgggggagccaagatcttgggggtcctccgagtcttgcggctcctgcgcacccta
cgccccctgcgtgtcatcagccgggcgccgggcctgaagctggtggtggagacactcatc
tcctccctcaagcccatcggcaacatcgtgctcatctgctgtgccttcttcatcatcttt
ggcatcctgggagtgcagctcttcaagggcaagttctaccactgtctgggcgtggacacc
cgcaacatcaccaaccgctcggactgcatggccgccaactaccgctgggtccatcacaaa
tacaacttcgacaacttgggccaggctctgatgtccctctttgtcctggcatccaaggat
ggttgggtgaacatcatgtacaatggactggatgctgttgctgtggaccagcagcctgtg
accaaccacaacccctggatgctgttgtacttcatctccttcctgctcatcgtcagcttc
tttgtgctcaacatgtttgtgggtgtcgtggtggagaacttccacaagtgccggcagcac
caggaggctgaagaggcgcggcggcgtgaggagaagcggctgcggcgcctcgagaagaag
cgccggaaggcccagcggctgccctactatgccacctattgtcacacccggctgctcatc
cactccatgtgcaccagtcactacctggacatcttcatcaccttcatcatctgcctcaac
gtggtcaccatgtccctggagcactacaatcagcccacgtccctggagacagccctcaag
tactgcaactatatgttcaccactgtctttgtgctggaggctgtgctgaagctggtggca
tttggtctgaggcgcttcttcaaggaccgatggaaccagctggacctggccattgtgcta
ctgtcagtcatgggcatcaccctggaggagattgagatcaatgcggccctgcccatcaat
cccaccatcatccgcatcatgagggttctgcgcattgcccgagtgctgaagctgttgaag
atggccacgggaatgcgggccctgctggacacggtggtgcaagctttgccccaggtgggc
aacctgggcctcctcttcatgctgctcttcttcatctatgctgctctcggggtggagctc
tttgggaagctggtctgcaacgacgagaacccgtgcgagggcatgagccggcatgccacc
ttcgagaacttcggcatggccttcctcacactcttccaggtctccacgggtgacaactgg
aacgggatcatgaaggacacgctgcgggactgcacccacgacgagcgcagctgcctgagc
agcctgcagtttgtgtcgccgctgtacttcgtgagcttcgtgctcaccgcgcagttcgtg
ctcatcaacgtggtggtggctgtgctcatgaagcacctggacgacagcaacaaggaggcg
caggaggacgccgagatggatgccgagctcgagctggagatggcccacggcctgggccct
ggcccgaggctgcctaccggctcccccgggcggccccctggccgagggccgggaggggcg
ggcggcgggggcgacaccgagggcggcttgtgccggcgctgctactcgcctgcccaggag
aacctgtggctggacagcgtctctttaatcatcaaggactccttggagggggagctgacc
atcatcgacaacctgtcgggctccatcttccaccactactcctcgcctgccggctgcaag
aagtgtcaccacgacaagcaagaggtgcagctggctgagacggaggccttctccctgaac
tcagacaggtcctcgtccatcctgctgggtgacgacctgagtctcgaggaccccacagcc
tgcccacctggccgcaaagacagcaagggtgagctggacccacctgagcccatgcgtgtg
ggagacctgggcgaatgcttcttccccttgtcctctacggccgtctcaccggatccagag
aacttcctgtgtgagatggaggagatcccattcaaccctgtccggtcctggctgaaacat
gacagcagtcaagcacccccaagtcccttctccccggacgcctccagccctctcctgccc
atgccagccgagttcttccaccctgcagtgtctgccagccagaaaggcccagaaaagggc
actggcacaggaaccctccccaagattgcgctgcagggctcctgggcatctctgcggtca
ccaagggtcaactgtaccctcctccggcaggccaccgggagcgacacgtcgctggacgcc
agccccagcagctccgcgggcagcctgcagaccacgctcgaggacagcctgaccctgagc
gacaagctggagccgggagacgccgccagcaagaggaagagatga

KEGG   Pan paniscus (bonobo): 100983134
Entry
100983134         CDS       T02283                                 

Gene name
CACNA1H
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 H
  KO
K04855  voltage-dependent calcium channel T type alpha-1H
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04020  Calcium signaling pathway
pps04713  Circadian entrainment
pps04925  Aldosterone synthesis and secretion
pps04927  Cortisol synthesis and secretion
pps04929  GnRH secretion
pps04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100983134 (CACNA1H)
   04020 Calcium signaling pathway
    100983134 (CACNA1H)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100983134 (CACNA1H)
   04925 Aldosterone synthesis and secretion
    100983134 (CACNA1H)
   04927 Cortisol synthesis and secretion
    100983134 (CACNA1H)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100983134 (CACNA1H)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100983134 (CACNA1H)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100983134 (CACNA1H)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100983134 (CACNA1H)
SSDB
Motif
Pfam: Ion_trans PKD_channel
Other DBs
NCBI-GeneID: 100983134
NCBI-ProteinID: XP_003808892
Position
16
AA seq 2237 aa
MLVIMLNCVTLGMFRPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGLFGQKCY
LGDTWNRLDFFIVVAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDT
LPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQTEEGEE
NPFICSSRRDNGMQKCSHIPGRRELRVPCTLGWEAYTQPQAEGVGAARNACINWNQYYNV
CRSGDSNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVG
SFFMINLCLVVIATQFSETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEELLKYVGH
IFRKVKRRSLRLYARWQSRWRKKVDPSAVQGQGPGHRQRRAGRHTASVHHLVYHHHHHHH
HHYHFSHGSPRRPGPEPGACDTRLVRAGAPPSPPSPGRGPPDAESVHSIYHADCHIEGPQ
ERARVAHAAATAAASLRLATGLGTMNYPTILPSGVGSGKGSTSPGPKGKWAGGPPGAGGH
GPLSLNSPDPYEKIPHVVGEHGLGQAPGHLSGLSVPCPLPSPPAGTLTCELKSCPYCTRA
LEDPEGELSGSESGDSDGRGVYEFTQDIRHGDRQDPTRPPPATDTPGPGPGSPRRRAQQR
AAPGEPGWMGRLWVTFSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALE
ISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADGGLSVLRTF
RLLRVLKLVRFLPALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTD
TGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVL
FNLLVAILVEGFQAEGDANRSDTDEDKTSVHFEEDLHKLRELQSAELKMCSLAVTPNGHL
EGRGSLSPPLIMCTAATPMPTPKSSPFLDAAPSLPDSRRGSSSSGDPPLGDQKPPASLRS
SPCAPWGPSGAWSSRRSSWSSLGRAPSLKRRGQCGERESLLSGEGKGSTDDEAEDGRAAP
GPRATPLRRAESLDPRPLRPAALPPTKCRDRDGQVVALPSDFFLRIDSHREDAAELDDDS
EDSCCLRLHKVLEPYKPQWCRSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFL
NCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNL
LDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISS
LRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGPDTRNISTKAQCRAAHYRWVRRKYN
FDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFV
LNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRSTFPSPEAQRRPYYADYSPT
RRSIHALCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAAL
KLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVL
KLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLS
RHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLRECSREDKHCLSYLPALSPVYFVTFVLV
AQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESP
GARDAPNLLVARKVSVSRMLSLPNDSYMFRPVVPASAPHPRPLQEVEMETYGAGTPLESC
ASLQIPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDSPRDTLD
PAEPGEKTPVRPVTQGGSLQSPPRSPRPASIRTRKHTFGQRCVSSRPAAPGGEEAEASDP
ADEEVSHITSSACPWQPTAVPHGPEASPVAGGERDPRRLYSVDAQGFLDKPGRADEQWRP
SAEPGSGEPGEAKAWGPEAEPALGARRKKKMSPPCISVEPPAEDEGSARPPAAEGGSTTL
RRRTPSCEATPHRDSLEPTEGSGAGGDPAAKGERWGQASCRAEHLTVPSFAFEPLDLGVP
SGDPFLDGSHSVTPESRASSSGAIVPLEPPESEPPMPVGDPPEKRRGLYLTVPQCPLEKP
GSPSTTPAPGGGADDPV
NT seq 6714 nt   +upstreamnt  +downstreamnt
atgctggtaatcatgctcaactgcgtgaccctgggcatgttccggccctgtgaggacgtt
gagtgcggctccgagcgctgcaacatcctggaggcctttgacgccttcattttcgccttt
tttgcggtggagatggtcatcaagatggtggccttggggctgttcgggcagaagtgttac
ctgggtgacacgtggaacaggctggatttcttcatcgtcgtggcgggcatgatggagtac
tcgttggacggacacaacgtgagcctctcggctatcaggaccgtgcgggtgctgcggcct
ctccgcgccatcaaccgcgtgcctagcatgcggatcctggtcactctgctgctggatacg
ctgcccatgctcgggaacgtccttctgctgtgcttcttcgtcttcttcattttcggcatc
gttggcgtccagctttgggctggcctcctgcggaaccgctgctttctggacagtgccttt
gtcaggaacaacaacctgaccttcctgcggccgtactaccagacggaggagggcgaggag
aacccgttcatctgctcctcgcgccgagacaacggcatgcagaagtgctcgcacatcccc
ggccgccgcgagctgcgcgtgccctgcaccctgggctgggaggcctacacgcagccgcag
gccgagggggtgggcgctgcacgcaacgcctgcatcaactggaaccagtactacaacgtg
tgccgctcaggtgactccaacccccacaacggtgccatcaacttcgacaacatcggctac
gcctggattgccatcttccaggtgatcacgctggaaggctgggtggacatcatgtactac
gtcatggacgctcactcgttctacaacttcatctatttcatcctgctcatcatcgtgggc
tccttcttcatgatcaacctgtgcctggtggtgattgccacgcagttctcggagacgaag
cagcgggagagtcagctgatgcgggagcagcgggcacgccacctgtccaacgacagcacg
ctggccagcttctccgagcctggcagctgctacgaagagctgctgaagtacgtgggccac
atattccgcaaggtcaagcggcgcagcttgcgcctctacgcccgctggcagagccgctgg
cgcaagaaggtggaccccagtgctgtgcaaggccagggtcccgggcaccgccagcgccgg
gcgggcaggcacacagcctcggtgcaccacctggtctaccaccaccatcaccaccaccac
caccactaccatttcagccacggcagcccccgcaggcctggccccgagccaggcgcctgc
gacaccaggctggtccgagctggcgcgcccccctcaccaccttccccaggccgcggaccc
cccgatgcagagtcagtgcacagcatctaccatgccgactgccacatagaggggccgcag
gagagggcccgggtggcacatgccgcagccactgccgccgccagcctcaggctggccaca
gggctgggcaccatgaactaccccacgatcctgccctcaggggtgggcagcggcaaaggc
agcaccagccccggacccaaggggaagtgggccggtggaccgccaggcgccggggggcac
ggcccgttgagcttgaacagccctgatccctacgagaagatcccgcatgtggtcggggag
catggactgggccaggcccctggccatctgtcgggcctcagtgtgccctgccccctgccc
agccccccagcgggcacactgacctgtgagctgaagagctgcccgtactgcacccgtgcc
ctggaggacccggagggtgagctcagcggctcggaaagtggagactcagatggccgtggc
gtctatgaattcacgcaggacatccggcacggtgaccgccaggaccccacgcgaccaccc
cctgcgacggacacaccaggcccaggcccaggcagcccccggcggcgggcacagcagagg
gcagccccgggcgagccaggctggatgggccgcctctgggttaccttcagcggcaagctg
cgccgcatcgtggacagcaagtacttcagccgtggcatcatgatggccatcctcgtcaac
acgctgagcatgggcgtggagtaccatgagcagcccgaggagctgactaatgctctggag
atcagcaacatcgtgttcaccagcatgttcgccctggagatgctgctgaagctgctggcc
tgcggccctctgggctacatccggaacccgtacaacatcttcgacggcatcattgtggtc
atcagcgtctgggagatcgtggggcaggcggacggtggcttgtctgtgctgcgcaccttc
cggctgctgcgtgtgctgaagctggtgcgctttctgccagccctgcggcgccagctcgtg
gtgctggtgaagaccatggacaacgtagctaccttctgcacgctgctcatgctcttcatt
ttcatcttcagcatcctgggcatgcaccttttcggctgcaagttcagcctgaagacagac
accggagacaccgtgcctgacaggaagaacttcgactccctgctgtgggccatcgtcacc
gtgttccagatcctgacccaggaggactggaacgtggtcctgtacaacggcatggcctcc
acctcctcctgggccgccctctacttcgtggccctcatgaccttcggcaactacgtgctc
ttcaacctgctggtggccatcctcgtggagggcttccaggcggagggcgatgccaacaga
tccgacacggacgaggacaagacgtcggtccacttcgaggaggacttgcacaagctcaga
gaactccagagcgcagagctgaagatgtgttccctggccgtgacccccaacgggcacctg
gagggacgaggcagcctgtcccctcccctcatcatgtgcacagctgccacgcccatgcct
acccccaagagctcgccattcctggatgcagcccccagcctcccagactctcggcgtggc
agcagcagctccggggacccgccactgggagaccagaagcctccggccagcctccgaagt
tctccctgtgccccctggggccccagtggcgcctggagcagccggcgctccagctggagc
agcctgggccgtgcccccagcctcaagcgccgcggccagtgtggggaacgtgagtccctg
ctgtctggcgagggcaagggcagcaccgacgacgaagctgaggacggcagggccgcgccc
gggccccgtgccaccccactgcggcgggccgagtccctggacccacggcccctgcggccg
gccgccctcccgcctaccaagtgccgcgatcgcgacgggcaggtggtggccctgcccagc
gacttcttcctgcgcatcgacagccaccgtgaggacgcggctgagcttgacgacgactcg
gaggacagctgctgcctccgcctgcataaagtgctggagccctacaagccccagtggtgc
cggagccgcgaggcctgggccctctacctcttctccccacagaaccggttccgcgtctcc
tgccagaaggtcatcacacacaagatgtttgatcacgtggtcctcgtcttcatctttctc
aactgcgtcaccatcgccctggagaggcctgacattgaccccggcagcaccgagcgggtc
ttcctcagcgtctccaattacatcttcacggccatcttcgtggcggagatgatggtgaag
gtggtggccctggggctgctgtccggcgagcacgcctacctgcagagcagctggaacctg
ctggatgggctgctggtgctggtgtccctggtggacattgtcgtggccatggcctcggct
ggtggcgccaagatcctgggtgttctgcgcgtgctgcgtctgctgcggaccctgcggcct
ctgagggtcatcagccgggccccgggcctcaagctggtggtggagacgctgatatcgtcg
ctcaggcccattgggaacatcgtcctcatctgctgcgccttcttcatcatttttggcatc
ttgggcgtgcagctcttcaaagggaagttctactactgcgagggccccgacaccaggaac
atctccaccaaggcacagtgccgggccgcccactaccgctgggtgcgacgcaagtacaac
ttcgacaacctgggccaggccctgatgtcgctgtttgtgctgtcatccaaggatggatgg
gtgaacatcatgtacgacgggctggacgctgtgggtgtcgaccagcagcctgtgcagaac
cacaacccctggatgctgctgtacttcatctccttcctgctcatcgtcagcttcttcgtg
ctcaacatgttcgtgggcgtcgtggtcgagaacttccacaagtgccggcagcaccaggag
gcggaggaggcgcggcggcgtgaggagaagcggctgcggcgcctagagaggaggcgcagg
agcactttccccagcccagaggcccagcgccggccctactatgccgactactcgcccacg
cgccgctccattcacgcgctgtgcactagccactatctcgatctcttcatcaccttcatc
atctgcgtcaacgtcatcaccatgtccatggagcactataaccaacccaagtcgctggac
gaggccctcaagtactgcaactacgtgttcaccatcgtgtttgtcttcgaggctgcactg
aagctggtagcatttgggttccgtcggttcttcaaggacaggtggaaccagctggacctg
gccatcgtgctgctgtcactcatgggcatcacgctggaggagatagagatgagcgccgcg
ctgcccatcaaccccaccatcatccgcatcatgcgcgtgctccgcatagcccgtgtgctg
aagctgctgaagatggccacaggcatgcgcgccctgctggacactgtggtgcaagctctc
ccccaggtggggaacctgggccttcttttcatgctcctgttttttatctatgctgcgctg
ggagtggagctgttcgggaggctggagtgcagtgaagacaacccctgcgagggcctgagc
aggcacgccaccttcagcaacttcggcatggccttcctcacgctgttccgcgtgtccacg
ggggacaactggaacgggatcatgaaggacacgctgcgcgagtgctcccgtgaggacaag
cactgcctgagctacctgccagccctgtcgcccgtctacttcgtgaccttcgtgctggtg
gcccagttcgtgctggtgaacgttgtggtagccgtgctcatgaagcacctggaggagagc
aacaaggaggcacgggaggatgcggagctggacgccgagatcgagctggagatggcgcag
ggccccgggagtgcacgccgggtggacgcggacaggcctcccttgccccaggagagtccg
ggcgccagggacgccccaaacctcctggttgcacgcaaggtgtccgtgtccaggatgctc
tcgctgcccaacgacagctacatgttcaggcccgtggtgcctgcctcggcgcctcacccc
cgcccgctgcaggaggtggagatggagacctatggggccggcacccccttggagtcctgt
gcctccctccagatcccattggctgtgtcatccccagccaggagcggcgagcccctccac
gccctgtcccctcggggcacagcccgctcccccagtctcagccggctgctctgcagacag
gaggctgtgcacaccgattccttggaagggaagattgacagccctagggacaccctggat
cctgcagagcctggcgagaaaaccccggtgaggccggtgacccaggggggctccctgcag
tccccaccacgctccccacggcccgccagcatccgcactcgtaagcatacctttggacag
cgctgcgtctccagccggccggcggccccaggcggagaggaggctgaggcctcggaccca
gccgacgaggaggtcagccacatcaccagctccgcctgcccctggcagcccacagccgtg
ccccatggccccgaagcctctccggtggccggcggcgagcgggacccgcgcaggctctac
agcgtggacgctcagggcttcctggacaagccgggccgggcagacgagcagtggcggccc
tcggcggagccgggcagcggggagcccggggaggcgaaggcctggggccctgaggccgag
cccgctctgggtgcacgcagaaagaagaagatgagccccccctgcatctcggtggaaccc
cctgcggaggacgagggctccgcgcggccccccgcggcagagggcggcagcaccacactg
agacgtaggaccccgtcctgtgaggccacccctcacagggactccctggagcccacagag
ggctcaggcgccgggggggaccctgcagccaagggggagcgctggggccaggcctcctgc
cgggccgagcacctgaccgtccccagctttgcctttgagccgctggacctcggggtcccc
agtggagaccctttcttggacggtagccacagtgtgaccccagaatccagagcttcctct
tcaggggccatagtgcccctggaacccccagaatcagagcctcccatgcccgttggtgac
cccccagagaagaggcgggggctgtacctcacagtcccccagtgtcctctggagaaacca
gggtccccctcaaccacccctgccccagggggtggtgcagatgacccggtgtag

KEGG   Pan paniscus (bonobo): 100983419
Entry
100983419         CDS       T02283                                 

Gene name
CACNA1G
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 G
  KO
K04854  voltage-dependent calcium channel T type alpha-1G
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04020  Calcium signaling pathway
pps04713  Circadian entrainment
pps04925  Aldosterone synthesis and secretion
pps04927  Cortisol synthesis and secretion
pps04929  GnRH secretion
pps04930  Type II diabetes mellitus
pps04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100983419 (CACNA1G)
   04020 Calcium signaling pathway
    100983419 (CACNA1G)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100983419 (CACNA1G)
   04925 Aldosterone synthesis and secretion
    100983419 (CACNA1G)
   04927 Cortisol synthesis and secretion
    100983419 (CACNA1G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100983419 (CACNA1G)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100983419 (CACNA1G)
   04934 Cushing syndrome
    100983419 (CACNA1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100983419 (CACNA1G)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100983419 (CACNA1G)
SSDB
Motif
Pfam: Ion_trans PKD_channel SieB
Other DBs
NCBI-GeneID: 100983419
NCBI-ProteinID: XP_008968902
Position
17
AA seq 2332 aa
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRTGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGXGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSS
SCSRAHRRLSVHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTP
ALSGAPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE
TLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCLKVDSG
ACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRSLGPDA
EPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI
VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV
AILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDANKSESEPDFFSPSLDGDGDRKKCL
ALVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA
HEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQ
DEEESSEEERASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCN
GKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFP
PQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAV
FLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVL
RLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFV
CQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVG
VDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRL
RRLEKKRRNLMLDDVIASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGV
IGLNVVTMAMEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDL
AIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQAL
PQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVST
GDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKE
AKEEAELEAELELEMKTLSPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASH
FSLEHPTDRQLFDTISLLIQGSLEWELKLMDELAGPGGQPSAFPSAPSLGGSDPQMQPHP
TELPGPDLLTVRKSGVSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQ
PADTSYILQLPKDAPHLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQG
LGSREDLLAEVSGPSPPLARAYSFWGQSSTQAQQHSRSHSKISKHMTPPAPCPGPEPNWG
KGPPETRSSLELDTELSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQSCQRRPTSWLDEQ
RRHSIAVSCLDSGSQPHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRPPP
SPGICLRRRAPSSDSKDPLASGPPDSMAASPSPKKDVLSLSGLSSDPADLDP
NT seq 6999 nt   +upstreamnt  +downstreamnt
atggacgaggaggaggatggagcgggcgccgaggagtcgggacagccccggagcttcatg
cggctcaacgacctgtcgggggccgggggccggacggggccggggtcagcagaaaaggac
ccaggcagcgcggactccgaggcggaggggctgccgtacccggcgctggccccggtggtt
ttcttctacttgagccaggacagccgcccgcggagctggtgtctccgcacggtctgtaac
ccctggtttgagcgcatcagcatgttggtcatccttctcaactgcgtgaccctgggcatg
ttccggccgtgcgaggacatcgcctgtgactcccagcgctgccggatcctgcaggccttt
gatgacttcatctttgccttctttgccgtggagatggtggtgaagatggtggccttgggc
atctttgggaaaaagtgttacctgggagacacttggaaccggcttgactttttcatcgtc
atcgcagggatgctggagtactcgctggacctgcagaacgtcagcttctcagctgtcagg
acagtccgtgtgctgcgaccgctcagggccattaaccgggtgcccagcatgcgcatcctt
gtcacgttgctgctggatacgctgcccatgctgggcaacgtcctgctgctctgcttcttc
gtcttcttcatcttcggcatcgtcggcgtccagctgtgggcagggctgcttcggaaccga
tgcttcctacctgagaatttcagcctccccctgagcgtggacctggagcgctattaccag
acagagaacgaggatgagagccccttcatctgctcccagccacgcgagaacggcatgcgg
tcctgcagaagcgtgcccacgctgcgcgggngagggggcggtggcccaccttgcggtctg
gactatgaggcctacaacagctccagcaacaccacctgtgtcaactggaaccagtactac
accaactgctcagcgggggagcacaaccccttcaagggcgccatcaactttgacaacatt
ggctatgcctggatcgccatcttccaggtcatcacgctggagggctgggtcgacatcatg
tactttgtgatggatgctcattccttctacaatttcatctacttcatcctcctcatcatc
gtgggctccttcttcatgatcaacctgtgcctggtggtgattgccacgcagttctcagag
accaagcagcgggaaagccagctgatgcgggagcagcgtgtgcggttcctgtccaacgcc
agcaccctggctagcttctctgagcccggcagctgctatgaggagctgctcaagtacctg
gtatacatccttcgtaaggcagcccgcaggctggctcaggtctctcgggcagcaggtgtg
cgggttgggctgctcagcagcccagcacccctcgggggccaggagacccagcccagcagc
agctgctctcgcgcccaccgccgcctatccgtccaccacctggtgcaccaccaccaccac
catcaccaccactaccacctgggcaatgggacgctcagggccccccgggccagcccggag
atccaggacagggatgccaatgggtcccgccggctcatgctgccaccaccctcgacgcct
gccctctccggggccccccctggtggcgcagagtctgtgcacagcttctaccatgccgac
tgccacttagagccagtccgctgccaggcgccccctcccaggtccccatctgaggcatcc
ggcaggactgtgggcagcgggaaggtgtatcccaccgtgcacaccagccctccaccagag
acgctgaaggagaaggcactagtagaggtggctgccagctctgggcccccaaccctcacc
agcctcaacatcccacccgggccctacagctccatgcacaagctgctggagacacagagt
acaggtgcctgccaaagctcttgcaagatctccagcccttgcttgaaagtagacagtgga
gcctgtggtccagacagctgcccctactgtgcccgggccggggcaggggaggtggagctc
gccgaccgcgaaatgcctgactcagacagcgaggcagtttatgagttcacacaggatgcc
cagcacagcgacctccgggacccccacagccggcggcaacggagcctgggcccagatgca
gagcccagctctgtgctggccttctggaggctaatctgtgacaccttccgaaagattgtg
gacagcaagtactttggccggggaatcatgatcgccatcctggtcaacacactcagcatg
ggcatcgaataccacgagcagcccgaggagcttaccaacgccctagaaatcagcaacatc
gtcttcaccagcctctttgccctggagatgctgctgaagctgcttgtgtatggtcccttt
ggctacatcaagaatccctacaacatcttcgatggtgtcattgtggtcatcagcgtgtgg
gagatcgtgggccagcaggggggcggcctgtcggtgctgcggaccttccgcctgatgcgt
gtgctgaagctggtgcgcttcctgccggcgctgcagcggcagctggtggtgctcatgaag
accatggacaacgtggccaccttctgcatgctgctcatgctcttcatcttcatcttcagc
atcctgggcatgcatctcttcggctgcaagtttgcctctgagcgggatggggacaccctg
ccagaccggaagaattttgactccttgctctgggccatcgtcactgtctttcagatcctg
acccaggaggactggaacaaagtcctctacaatggtatggcctccacgtcgtcctgggcg
gccctttatttcattgccctcatgaccttcggcaactacgtgctcttcaatttgctggtc
gccattctggtggagggcttccaggcggaggaaatcagcaaacgggaagatgcgagtgga
cagttaagctgtattcagctgcctgtcgactcccaggggggagatgccaacaagtccgaa
tcagagcccgatttcttctcacccagcctggatggtgatggggacaggaagaagtgcttg
gccctggtgtccctgggagagcacccggagctgcggaagagcctgctgccgcctctcatc
atccacacggccgccacacccatgtcgctgcccaagagcaccagcacgggcctgggcgag
gcgctgggccctgcgtcgcgccgcaccagcagcagcgggtcggccgagcctggggcggcc
cacgagatgaagtcaccgcccagcgcccgcagctccccgcacagcccctggagcgctgca
agcagctggactagcaggcgctccagccggaacagcctcggccgtgcccccagcctgaag
cggagaagcccaagtggagagcggcggtccctgttgtcgggagaaggccaggagagccag
gatgaagaggagagctcagaagaggagcgggccagccctgcgggcagtgaccatcgccac
agggggtccctggagcgggaggccaagagttcctttgacctgccagacacactgcaggtg
ccagggctgcatcgcactgccagtggccgagggtctgcttctgagcaccaggactgcaat
ggcaagtcggcttcagggcgcctggcccgggccctgcggcctgatgaccccccactggat
ggggatgatgccgatgacgagggcaacctgagcaaaggggaacgggtccgcgcgtggatc
cgagcccgactccctgcctgctgcctcgagcgagactcctggtcagcctacatcttccct
cctcagtccaggttccgcctcctgtgtcaccggatcatcacccacaagatgttcgaccac
gtggtccttgtcatcatcttccttaactgcatcaccatcgccatggagcgccccaaaatt
gacccccacagcgctgaacgcatcttcctgaccctctccaattacatcttcaccgcagtc
tttctggctgaaatgacagtgaaggtggtggcactgggctggtgcttcggggagcaggcg
tacctgcggagcagttggaacgtgctggacgggctgttggtgctcatctccgtcatcgac
attctggtatccatggtctctgacagcggcaccaagatcctgggcatgctgagggtgctg
cggctgctgcggaccctgcgcccgctcagggtgatcagccgggcgcaggggctgaagctg
gtggtggagacgctgatgtcctcactgaaacccatcggcaacattgtagtcatctgctgt
gccttcttcatcattttcggcatcttgggggtgcagctcttcaaagggaagtttttcgtg
tgccagggcgaggataccaggaacatcaccaataaatcggactgtgccgaggccagttac
cggtgggtccggcacaagtacaactttgacaaccttggccaggccctgatgtccctgttc
gttttggcctccaaggatggttgggtggacatcatgtacgatgggctggatgctgtgggc
gtggaccagcagcccatcatgaaccacaacccctggatgctgctgtacttcatctcgttc
ctgctcattgtggccttctttgtcctgaacatgtttgtgggtgtggtggtggagaacttc
cacaagtgtcggcagcaccaggaggaagaggaggcccggcggcgggaggagaagcgccta
cgaagactggagaaaaagagaaggaatctaatgctggacgatgtaattgcttccggcagc
tcagccagcgctgcgtcagaagcccagtgcaaaccttactactccgactactcccgcttc
cggctcctcgtccaccacttgtgcaccagccactacctggatctcttcatcacaggtgtc
atcgggctgaacgtggtcaccatggccatggagcactaccagcagccccagattctggat
gaggctctgaagatctgcaactacatcttcactgtcatctttgtcttggagtcagttttc
aaacttgtggcctttggtttccgtcggttcttccaggacaggtggaaccagctggacctg
gccattgtgctgctgtccatcatgggcatcacgctggaggaaattgaggtcaacgcctcg
ctgcccatcaaccctaccatcatccgcatcatgagggtgctgcgcattgcccgagtgctg
aagctgctgaagatggctgtgggcatgcgggcgctgctggacacggtgatgcaggccctg
ccccaggtggggaacctgggacttctcttcatgttgttgtttttcatctttgcagctctg
ggcgtggagctctttggagacctggagtgtgacgagacacacccctgtgagggcctgggc
cgtcatgccacctttcggaactttggcatggccttcctaaccctcttccgagtctccaca
ggtgacaattggaatggcattatgaaggacaccctccgggactgtgaccaggagtccacc
tgctacaacacggtcatctcgcctatctactttgtgtccttcgtgctgacggcccagttc
gtgctagtcaacgtggtgatcgccgtgctgatgaagcacctggaggagagcaacaaagag
gccaaggaggaggccgagctggaggctgagctggagctggagatgaagaccctcagcccc
cagccccactcgccacttggcagccccttcctctggcctggggtcgaggggcccgacagc
cccgacagccccaagcctggggctctgcacccagcggcccatgcgagatcagcctcccac
ttttccctggagcaccccacggacaggcagctgtttgacaccatatccctgctgatccag
ggctccctggagtgggagctgaagctgatggacgagctggcaggcccagggggccagccc
tctgccttcccttctgcccccagcctgggaggctccgacccacagatgcagccccacccc
acggagctgccaggaccagacttactgactgtgcggaagtctggggtcagccgaacgcat
tctctgcccaatgacagctacatgtgtcggcatgggagcactgccgaggggcccctggga
cacaggggctgggggctccccaaagctcagtcaggctccgtcttgtccgttcactcccag
ccagcagataccagctacatcctgcagcttcccaaagatgcacctcatctgctccagccc
cacagcgccccaacctggggcaccatccccaaactgcccccaccaggacgctcccctttg
gctcagaggccactcaggcgccaggcagcaataaggactgactccttggacgttcagggt
ctgggcagccgggaagacctgctggcagaggtgagtgggccctccccgcccctggcccgg
gcctactctttctggggccagtcaagtacccaggcacagcagcactcccgcagccacagc
aagatctccaagcacatgaccccgccagccccttgcccaggcccagaacccaactggggc
aagggccctccagagaccagaagcagcttagagttggacacggagctgagctggatttca
ggagacctcctgccccctggcggccaggaggagcccccatccccacgggacctgaagaag
tgctacagcgtggaggcccagagctgccagcgccggcccacgtcctggctggatgagcag
aggagacactctatcgccgtcagctgcctggacagcggctcccaaccccacctgggcaca
gacccctctaaccttgggggccagcctcttggggggcccgggagccggcccaagaaaaaa
ctcagcccgcctagtatcaccatagacccccccgagagccaaggtcctcggcccccgccc
agccctggcatctgcctccggaggagggctccgtccagcgactccaaggatcccttggcc
tctggcccccctgacagcatggctgcctcgccctccccaaagaaagatgtgctgagtctc
tccggtttatcctctgacccagcagacctggacccctga

DBGET integrated database retrieval system