KEGG   Pan paniscus (bonobo): 100972583
Entry
100972583         CDS       T02283                                 

Gene name
DDB2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03420  Nucleotide excision repair
pps04115  p53 signaling pathway
pps04120  Ubiquitin mediated proteolysis
pps05161  Hepatitis B
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05216  Thyroid cancer
pps05217  Basal cell carcinoma
pps05218  Melanoma
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100972583 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100972583 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100972583 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972583 (DDB2)
   05202 Transcriptional misregulation in cancer
    100972583 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100972583 (DDB2)
   05212 Pancreatic cancer
    100972583 (DDB2)
   05225 Hepatocellular carcinoma
    100972583 (DDB2)
   05226 Gastric cancer
    100972583 (DDB2)
   05214 Glioma
    100972583 (DDB2)
   05216 Thyroid cancer
    100972583 (DDB2)
   05220 Chronic myeloid leukemia
    100972583 (DDB2)
   05217 Basal cell carcinoma
    100972583 (DDB2)
   05218 Melanoma
    100972583 (DDB2)
   05213 Endometrial cancer
    100972583 (DDB2)
   05224 Breast cancer
    100972583 (DDB2)
   05222 Small cell lung cancer
    100972583 (DDB2)
   05223 Non-small cell lung cancer
    100972583 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100972583 (DDB2)
   05169 Epstein-Barr virus infection
    100972583 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100972583 (DDB2)
   03400 DNA repair and recombination proteins [BR:pps03400]
    100972583 (DDB2)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100972583 (DDB2)
DNA repair and recombination proteins [BR:pps03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100972583 (DDB2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 100972583
NCBI-ProteinID: XP_003815239
UniProt: A0A2R8Z6C7
Position
11
AA seq 427 aa
MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGP
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtcccctggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagatgtgactcagactgcctctgggtggggctggctggccca
cagatcctgccaccatgccgcagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaggctgccccctttgacaggagggctacatccttggcgtggcac
ccaactcaccccagcaccgtggctgtgggttccaaagggggagatatcatgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtctgctagtagccgaatggtggtcacaggagac
aacgtggggaacgtgatcctgctgaacatggacggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatttgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcctgatgga
gcccggctcctgaccacggaccagaagagcgagatccgagtttactctgcttcccagtgg
gactgccccctgggcctgatcccgcaccctcaccgtcacttccagcacctcacacccatc
aaggcagcctggcatcctcgctacaacctcattgttgtgggccgatacccagatcctaat
ttcaaaagttgtaccccttatgaattgaggacgatcgatgtgttcgatggaaactcaggg
aagatgatgtgtcagctctatgacccagaatcttctggcatcagttcgcttaatgaattc
aatcccatgggggacacgctggcctctgcaatgggttaccacattctcatctggagccag
gaggaagccaggacacggaagtga

DBGET integrated database retrieval system