KEGG   Pan paniscus (bonobo): 100972631
Entry
100972631         CDS       T02283                                 

Gene name
ORAI3
Definition
(RefSeq) ORAI calcium release-activated calcium modulator 3
  KO
K16058  calcium release-activated calcium channel protein 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100972631 (ORAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100972631 (ORAI3)
Ion channels [BR:pps04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   100972631 (ORAI3)
SSDB
Motif
Pfam: Orai-1 KASH DUF2207
Other DBs
NCBI-GeneID: 100972631
NCBI-ProteinID: XP_003807564
Position
16
AA seq 257 aa
MGASQHSLRALSWRRLYLSRAKLKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAF
SACTTVLVAVHLFALMVSTCLLPHIEAVSNIHNLNSVHQSPHQRLHRYVELAWGFSTALG
TFLFLAEVVLVGWVKFVPIGAPLDTPTPMVPTSRVPGTLAPVATSLSPASNLPPSSASAA
PSQAEPACPPRQACGGGGAHGPGWQAAMASTAIMVPVGLVFVAFALHFYRSLVAHKTDRY
KQELEELNRLQGELQAV
NT seq 774 nt   +upstreamnt  +downstreamnt
atgggggccagtcagcactcgctgcgggcgctcagctggcgccgcctctacctcagccgg
gccaagctcaaagcttccagccgcacgtctgccctgctctcgggcttcgccatggtggcc
atggtggaggtgcagctggagagcgaccacgagtacccaccaggcctgctggtggccttc
agtgcctgcaccaccgtgctggtggctgtgcacctctttgcactcatggtctccacgtgt
ctgctgccccacattgaagctgtgagcaacatccacaacctcaactctgtccaccagtcg
ccacaccagagactgcaccgctacgtggagctggcctggggcttctccactgccctgggc
acctttctcttccttgctgaagttgtcctggttggttgggtcaagtttgtgcccattggg
gctcccttggacacaccgacccccatggtgcccacatcccgggtgcctgggactctggca
ccagtggctacctcccttagtccagcttccaatctcccaccatcctctgcgtctgcagca
ccgtcccaggctgagccagcctgcccaccccggcaagcctgtggtggtggtggggcccat
gggccaggctggcaagcagccatggcctccacagccatcatggtacccgtggggctcgtg
tttgtggcctttgctctgcatttctaccgctccttggtggcacacaagacagaccgctac
aagcaggaactagaggaactgaatcgcctgcagggggagctgcaggctgtgtga

KEGG   Pan paniscus (bonobo): 100987781
Entry
100987781         CDS       T02283                                 

Gene name
ORAI1
Definition
(RefSeq) ORAI calcium release-activated calcium modulator 1
  KO
K16056  calcium release-activated calcium channel protein 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04611  Platelet activation
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04927  Cortisol synthesis and secretion
pps04934  Cushing syndrome
pps05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100987781 (ORAI1)
   04024 cAMP signaling pathway
    100987781 (ORAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100987781 (ORAI1)
  09152 Endocrine system
   04924 Renin secretion
    100987781 (ORAI1)
   04925 Aldosterone synthesis and secretion
    100987781 (ORAI1)
   04927 Cortisol synthesis and secretion
    100987781 (ORAI1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    100987781 (ORAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100987781 (ORAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100987781 (ORAI1)
Ion channels [BR:pps04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   100987781 (ORAI1)
SSDB
Motif
Pfam: Orai-1
Other DBs
NCBI-GeneID: 100987781
NCBI-ProteinID: XP_003832406
Position
12
AA seq 301 aa
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEXPGAPPPPPSAVTYPDWIGQSY
SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL
IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST
VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPAGGAAANVSTSGITPGQAAAIAST
TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY
A
NT seq 906 nt   +upstreamnt  +downstreamnt
atgcatccggagcccgccccgcccccgagccgcagcagccccgagcttcccccaagcggc
ggcagcaccaccagcggcagccgccggagccgccgccgcagcggggacggggagnccccg
ggggccccgccacctccgccgtccgccgtcacctacccggactggatcggccagagttac
tccgaggtgatgagcctcaacgagcactccatgcaggcgctgtcctggcgcaagctctac
ttgagccgcgccaagcttaaagcctccagccggacctcggctctgctctccggcttcgcc
atggtggcaatggtggaggtgcagctggacgctgaccacgactacccaccggggctgctc
atcgccttcagtgcctgcaccacagtgctggtggctgtgcacctgtttgcgctcatgatc
agcacctgcatcctgcccaacatcgaggcggtgagcaacgtgcacaatctcaactcggtc
aaggagtccccccacgagcgcatgcaccgccacatcgagctggcctgggccttctccact
gtcatcggcacgctgctcttcctggctgaggtggtgctgctctgctgggtcaagttctta
cccctcaagaagcagccaggccagccaaggcccaccagcaagccccccgccggtggtgca
gcagccaacgtcagcaccagcggcatcaccccgggccaggcagctgccatcgcctcgacc
accatcatggtgcccttcggcctgatctttatcgtcttcgccgtccacttctaccgctca
ctggtcagccataagaccgaccgacagttccaggagctcaacgagctggcggagtttgcc
cgcttacaggaccagctggaccacagaggggaccaccccctgacgcccggcagccactat
gcctag

KEGG   Pan paniscus (bonobo): 100988709
Entry
100988709         CDS       T02283                                 

Gene name
ORAI2
Definition
(RefSeq) ORAI calcium release-activated calcium modulator 2
  KO
K16057  calcium release-activated calcium channel protein 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100988709 (ORAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100988709 (ORAI2)
Ion channels [BR:pps04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   100988709 (ORAI2)
SSDB
Motif
Pfam: Orai-1 DUF2207
Other DBs
NCBI-GeneID: 100988709
NCBI-ProteinID: XP_003804370
Position
Un
AA seq 261 aa
MTCLAPTMSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKL
YLSRAKLKASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALL
ISTCILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKF
LPVDARRQPGPPPGPGSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNRE
IEELHKLKVQLDGHERSLQVL
NT seq 786 nt   +upstreamnt  +downstreamnt
atgacctgcctggctcccaccatgagtgctgagctcaacgtgcctattgacccctctgct
cctgcctgccctgagcccggccacaagggcatggattaccgggactgggtccgccgcagc
tacctggaactggtcacctctaaccaccactcggtacaggccctgtcgtggcggaagctc
tacctgagcagggccaagctgaaggcctccagcaggacctccgccctcctctccggcttt
gccatggtggccatggtggaggtgcagctggagacgcagtaccagtacccgcggccactg
ctgattgccttcagcgcctgcaccacggtgctggtggccgtgcacctgttcgccctcctc
atcagcacctgcatcctgcccaacgtggaggccgtgagcaacatccacaacctgaactcc
atcagcgagtccccgcacgagcgcatgcacccctacatcgagctggcctggggcttctcc
accgtgctcggcatcctactcttcctggccgaggtggtgctgctctgctggatcaagttc
ctccccgtggatgcccggcgccagcctggccccccacctggccctgggagtcacacgggc
tggcaggccgccctggtgtccaccatcatcatggtgcccgtgggcctcatcttcgtggtc
ttcaccatccacttctaccgctccctggtgcgccacaaaacggagcgccacaaccgcgag
atcgaggagctccacaagctcaaggtccagctggacgggcatgagcgcagcctgcaggtc
ttgtga

DBGET integrated database retrieval system