KEGG   Pan paniscus (bonobo): 100973331
Entry
100973331         CDS       T02283                                 

Gene name
ATP2B1
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04925  Aldosterone synthesis and secretion
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04972  Pancreatic secretion
pps04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100973331 (ATP2B1)
   04024 cAMP signaling pathway
    100973331 (ATP2B1)
   04022 cGMP-PKG signaling pathway
    100973331 (ATP2B1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100973331 (ATP2B1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100973331 (ATP2B1)
  09154 Digestive system
   04970 Salivary secretion
    100973331 (ATP2B1)
   04972 Pancreatic secretion
    100973331 (ATP2B1)
   04978 Mineral absorption
    100973331 (ATP2B1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100973331 (ATP2B1)
Enzymes [BR:pps01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100973331 (ATP2B1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3 DUF2201_N
Other DBs
NCBI-GeneID: 100973331
NCBI-ProteinID: XP_003823456
UniProt: A0A2R9CMI6
Position
12
AA seq 1220 aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQIRVVNAFRSSLYEGLEKPESRSS
IHNFMTHPEFRIEDSEPHIPLIDDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIHLTIEM
NKSATSSSPGSPLHSLETSL
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgggcgacatggcaaacaactcagttgcttacagtggtgtgaaaaactctttgaaggaa
gctaatcatgatggagactttggaattacgctcgcagagctgcgggctctcatggagctc
aggtccacagatgcattacgaaaaatacaggaaagctatggagacgtctatggaatttgc
accaaattgaaaacatctcccaatgaaggtttaagtggaaaccctgcagatttagaaaga
agagaagcagtgtttggaaagaattttatacctcctaaaaagccaaaaacctttcttcaa
ttagtatgggaagcattacaagatgtcactttaattatattagaaattgcagccatagta
tcattgggcctttctttttatcagcctccagaaggggataatgcactttgtggagaagtt
tctgttggggaggaagaaggtgaaggtgaaactggttggattgaaggagctgcaatcctc
ttgtctgtagtgtgtgtggtgttagtaacagctttcaatgactggagtaaggaaaaacag
tttagaggtttgcagagccgaattgaacaagaacagaagttcactgtcatcaggggtggt
caggtcattcagatacctgtagctgacattactgttggagatattgctcaagtgaaatat
ggtgatcttcttccagctgacggcatacttattcaaggcaacgatcttaaaattgatgaa
agctcattgactggtgaatcagatcatgttaaaaagtctttagataaggatcccttactt
ctatcaggtactcatgtaatggaaggctctggaagaatggtagttacagctgtaggtgta
aattctcaaactggaattatctttaccttacttggagctggaggtgaagaggaagagaag
aaagatgagaagaaaaaggaaaagaaaaataagaaacaagatggagctattgagaatcgc
aacaaagcaaaagcccaggatggtgcagccatggaaatgcagccattgaagagtgaagaa
ggtggagatggtgatgaaaaagataaaaagaaagcaaatttgccaaaaaaggaaaaatct
gttttacaagggaaacttacaaaactggctgttcagattggcaaagcaggtctgttgatg
tctgccatcacagttatcattctagtattatattttgtcattgacaccttctgggttcag
aaaagaccatggcttgctgagtgcacaccaatttatatacaatactttgtgaagttcttc
attattggagttacagttttagtggtcgcagtgccagaaggtcttccacttgcagtcacg
atctcactggcttattcagtcaaaaaaatgatgaaagataataacttagtaaggcatctg
gatgcttgtgaaaccatgggaaatgctacagctatttgttcagataaaacaggaacgttg
acaatgaacagaatgacagtcgttcaagcttacataaatgaaaaacattataaaaaggtt
cctgaaccagaagctattccaccaaatattttgtcctatcttgtaacaggaatttctgtg
aattgtgcttatacatcaaaaatattgccaccagagaaagagggtggattacctcgtcac
gttggtaataaaactgaatgtgccttgttgggacttcttttggatttaaaacgggattat
caggatgttagaaatgaaataccagaagaagcactgtacaaagtctacaccttcaattct
gttaggaagtccatgagtactgtcctgaaaaattcagatggaagttatcgaatattcagc
aagggtgcatctgagataattctgaaaaagtgtttcaaaatcttgagtgctaatggtgag
gcaaaagtgttcagaccaagggaccgtgatgatattgtaaaaactgtgattgaaccgatg
gcatcagaaggcttgagaaccatatgtcttgcattcagagattttccagcaggagaacca
gaaccagagtgggataatgaaaatgatattgtcaccggccttacatgcattgctgttgtg
gggattgaagatcctgtgagacctgaggtgccagatgcaattaaaaagtgtcagagggct
ggaattactgtgcggatggtcactggtgataatattaatactgctcgggccattgctacc
aaatgtggtattttacatcctggggaagattttctgtgcctagaaggtaaagattttaac
agaagaatacgaaatgaaaaaggagagattgagcaagagaggatagacaagatttggcca
aaacttcgagtacttgcaagatcatctcctactgataagcatacactggttaaaggtata
attgacagcactgtctcagaccaacgccaggttgtagctgtaactggtgatggtacaaat
gatggcccagcactaaagaaggcagatgttggatttgcaatgggtattgctggaactgat
gtagctaaagaagcatccgatattattctcacagatgacaactttacaagcattgttaaa
gcagttatgtggggacgaaatgtctatgacagcatctcaaaattccttcagttccaactt
actgttaatgtagtagcagtgattgttgcttttacgggcgcctgcattactcaagactca
ccgcttaaggctgtgcagatgctgtgggtaaacctcataatggatacactcgcttccctg
gctctggcaacggaaccacccactgagtctctcttgcttcggaaaccttatggtagaaat
aagcctctcatctcacgtacaatgatgaagaatattttgggtcatgcattctatcaactt
gtagtagtctttacactcttatttgctggagaaaagttttttgacattgatagtggaaga
aatgctcctttgcatgctcctccttcagaacattatactattgtttttaatacctttgtg
ctgatgcaacttttcaacgaaataaatgcccggaaaattcatggtgaaagaaatgtattc
gaaggaatctttaacaatgccatcttctgcacaattgttttaggcacttttgtggtacag
ataataattgtgcagtttggtggaaaacctttcagttgttcagaactttcaatagaacag
tggctatggtcaatattcctaggaatgggaacattactctggggccagcttatttcaaca
attccaactagccgtttaaaattcctcaaagaagctggtcatggaacacaaaaggaagaa
atacctgaggaggaattagcagaggatgttgaagagattgatcacgctgaaagggagttg
cggcgtggccaaatcttgtggtttagaggtctgaacagaatccaaacacagattcgagtg
gtgaatgcatttcgtagttctttatatgaagggttagaaaaaccggaatcaagaagttcg
attcacaactttatgacacatcctgagtttaggatagaagattcagagcctcatatcccc
cttattgatgacactgatgccgaagatgatgctcctacaaaacgtaactccagtcctcca
ccctctcccaacaaaaataacaatgctgttgacagtggaattcaccttacaatagaaatg
aacaagtctgctacctcttcatccccaggaagcccactacatagtttggaaacatcactc
tga

KEGG   Pan paniscus (bonobo): 100978284
Entry
100978284         CDS       T02283                                 

Gene name
ATP2B3
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 3
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04925  Aldosterone synthesis and secretion
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04972  Pancreatic secretion
pps04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100978284 (ATP2B3)
   04024 cAMP signaling pathway
    100978284 (ATP2B3)
   04022 cGMP-PKG signaling pathway
    100978284 (ATP2B3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100978284 (ATP2B3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100978284 (ATP2B3)
  09154 Digestive system
   04970 Salivary secretion
    100978284 (ATP2B3)
   04972 Pancreatic secretion
    100978284 (ATP2B3)
   04978 Mineral absorption
    100978284 (ATP2B3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100978284 (ATP2B3)
Enzymes [BR:pps01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100978284 (ATP2B3)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 100978284
NCBI-ProteinID: XP_003804897
UniProt: A0A2R8ZZC5
Position
X
AA seq 1220 aa
MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLC
RRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVL
QGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFII
GVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTT
NRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVG
NKTECALLGFVLDLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKG
ASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPD
WDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCG
IIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDS
TTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVM
WGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALA
TEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAP
LHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVI
VQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTD
EELAEGEEEIDHAERELRRGQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESKTSIHN
FMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSA
TSSVFSSSPGSPLHSVETSL
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgggcgacatggccaatagttccatcgagttccaccccaagccccagcagcagcgggat
gtcccccaggctggaggctttgggtgcacgctggcggagctgcgcaccctcatggagctg
cgaggggccgaggcgctgcagaagatcgaggaggcctacggggatgtcagcgggctctgc
cggaggctgaagacctcacccacagagggcctggcggacaacaccaatgacctggagaag
cgcaggcagatctacgggcagaacttcatccccccaaagcaacccaagaccttcctgcag
ctggtgtgggaggccctgcaggacgtgaccctcatcatcctggaggtggctgccatcgtc
tctctgggcctctcgttctatgcgccgccaggagaggagagtgaagcctgtgggaatgtg
tcgggaggcgcagaagatgagggcgaggccgaagctggctggatcgagggggctgccatc
ctgctgtccgtcatctgtgtggtgctggtcacggccttcaatgactggagcaaggagaag
cagttccgaggcctgcagagccgaattgagcaggagcagaagttcacggtcatccggaac
gggcagctcctccaggtccccgtggctgcgctggtggtgggggacattgcccaggtcaag
tacggcgacctgctgccagccgacggcgtgctcatccaggccaatgacctcaagatcgac
gagagctccctgacgggcgagtctgaccacgtgcgcaagtcagctgacaaagatcccatg
ctgctctcaggcactcatgtcatggaaggttctggaagaatggtggtgaccgccgttggc
gtgaattcccagacaggcatcatcttcacgctgcttggagctggcggagaggaggaagag
aagaaagataagaaaggcaagcagcaggatggggccatggagagtagccagaccaaagct
aagaagcaggatggtgcagtggccatggagatgcagcccctgaagagcgcggagggtggg
gagatggaggagcgggagaagaagaaagccaacgcacccaagaaggagaagtctgtcctt
caggggaagctcacaaagctagccgtgcagatcgggaaagcagggctggtgatgtctgcc
atcaccgtcatcatcctggtcctctactttgtgattgagacgtttgtcgtggaaggccgg
acatggctggcagagtgcacgccggtctatgtacaatacttcgtgaagttcttcatcatt
ggtgtcactgtgctggtcgtggctgtcccagagggcctgcctcttgctgtcaccatctcc
ttagcttactctgtcaagaaaatgatgaaagacaacaacctggtgcgccacctggatgcc
tgcgagaccatgggcaacgccacagccatctgctccgacaagacgggcacgctcaccacc
aaccgtatgaccgtggtccagtcctacctaggggacacccactacaaagagattccggcc
cccagcgccctgacccctaagatcctcgacctcctggtccatgccatctccatcaacagt
gcctataccaccaaaatactacctcctgagaaggaaggcgccctcccacgccaggtgggc
aataagacagagtgcgccctgctgggcttcgtcttggacctgaagcgggacttccagccc
gtgcgcgagcagatcccagaagacaagctttacaaagtgtacaccttcaactcggtccgc
aagtccatgagcacagtcatccgcatgcccgacggtggcttccgcctcttcagcaagggg
gcctcagagatcctgttgaaaaagtgcaccaacatcttgaacagcaatggcgaactccgg
ggctttcggcctcgggaccgggacgacatggtgaggaagatcatcgagccgatggcttgc
gatggcctccgcaccatctgcatcgcctaccgggacttctctgcaggccaggagcccgac
tgggacaacgagaatgaggtcgtgggtgacctcacctgcatagctgtcgtgggcattgag
gaccctgtgcggcccgaggtccctgaagctatccgaaaatgccagcgtgctggcatcaca
gtccgcatggtgactggggacaacatcaacacggcccgggccatcgcagccaaatgtggc
atcatccagcccggggaggacttcctgtgcctagaagggaaggagttcaaccggcggatc
cgcaatgagaaaggcgagatagaacaggagcggctggacaaggtgtggcccaagctgagg
gtgctggcccggtcgtctcccaccgacaagcacacactggtcaaagggattatcgacagc
accactggtgagcagcggcaggtggtggctgtgacgggggatggcaccaacgatgggccg
gccctcaagaaggcggacgtgggcttcgccatgggcatcgcagggaccgacgtggccaag
gaggcctccgacatcatcttgaccgatgacaacttcaccagcatcgtcaaggcagtcatg
tggggccgtaacgtctatgacagcatctccaagttcctgcagtttcaactgacggtcaat
gtggtggctgtgatcgtggccttcacaggtgcctgcattactcaggactctcctctcaaa
gccgtgcagatgttgtgggtgaacttgatcatggacacgtttgcctctctggccctggcg
acggagccacccacagagtcgctgctgctgcggaagccgtacggccgcgacaagcccctc
atctcccgcaccatgatgaagaacattctgggccacgccgtgtaccagctcgccatcatc
ttcaccctgctgtttgtcggggagctcttcttcgacatcgacagcgggaggaatgcgccc
ctgcactcgccaccctcagagcactacaccatcatcttcaacacgttcgtcatgatgcag
ctctttaacgagatcaacgcccgcaagatccacggcgagaggaacgtgttcgacggcatc
ttcagcaaccccatcttctgcaccatcgttttgggcactttcgggattcagattgtcatc
gtccagttcggcgggaagcccttcagctgctccccactatccacagaacagtggctctgg
tgcctgtttgttggtgttggggagctggtctggggacaggtcattgccaccatccccacc
agccagctcaagtgcctgaaggaagccgggcacgggcccgggaaggacgagatgaccgac
gaggagctggccgaaggcgaggaagagatcgaccacgccgagcgggagctccgcaggggc
cagatcctctggttccggggcctgaaccggattcagacgcagatccgggtggtgaaagcg
ttccgtagctcgctctatgaaggcctggagaaaccagaatccaagacctccattcacaac
ttcatggccacgcccgagtttctgatcaatgactacacccacaacatcccgctcattgac
gacacggacgtggacgagaacgaggagcgcctccgggcccccccgcccccgtcccccaac
cagaacaacaacgccatagacagcggcatctacctgaccacgcatgtcaccaagtcagct
acctcttcagtgttttcctccagtcccgggagcccgctccacagcgtggagacgtccctc
taa

KEGG   Pan paniscus (bonobo): 100982359
Entry
100982359         CDS       T02283                                 

Gene name
ATP2B2
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 2
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04925  Aldosterone synthesis and secretion
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04972  Pancreatic secretion
pps04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100982359 (ATP2B2)
   04024 cAMP signaling pathway
    100982359 (ATP2B2)
   04022 cGMP-PKG signaling pathway
    100982359 (ATP2B2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100982359 (ATP2B2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100982359 (ATP2B2)
  09154 Digestive system
   04970 Salivary secretion
    100982359 (ATP2B2)
   04972 Pancreatic secretion
    100982359 (ATP2B2)
   04978 Mineral absorption
    100982359 (ATP2B2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100982359 (ATP2B2)
Enzymes [BR:pps01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100982359 (ATP2B2)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 100982359
NCBI-ProteinID: XP_003826325
UniProt: A0A2R9CK00
Position
3
AA seq 1198 aa
MGDMTNSDFYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRL
KTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGEGNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQVKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMLVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKAKQQDGAAAMEMQPLKSAEGGDADDRKKASMHKKEKSVLQGKLTKLAVQIGKAGLVMS
AITVIILVLYFTVDTFVVNKKPWLPECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTI
SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIP
DPSSINTKTMELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLKQDYE
PVRSQMPEEKLYKVYTFNSVRKSMSTVIKLPDESFRMYSKGASEIVLKKCCKILNGAGEP
RVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNELTCICVVGI
EDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRR
IRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDG
PALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTV
NVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKP
LISRTMMKNILGHAVYQLALIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYTIIFNTFVMM
QLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWM
WCIFIGLGELVWGQVIATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAERELRR
GQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPHIPLI
DDTDLEEDAALKQNSSPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPIHSLETSL
NT seq 3597 nt   +upstreamnt  +downstreamnt
atgggtgacatgaccaacagcgacttttactccaaaaaccaaagaaatgagtcgagccat
gggggcgagttcgggtgcacaatggaggagctccgctccctcatggagctgcggggcact
gaggctgtggtcaagatcaaggagacttatggggacaccgaagccatctgccggcgcctc
aaaacctcacctgttgaaggtttgccgggcaccgctccagacctggaaaagagaaagcaa
atttttgggcaaaactttatacctccaaagaagccaaaaaccttcctgcagctcgtgtgg
gaggcgctgcaggacgtgacgctcatcatcctggagatcgccgccatcatctccctgggg
ctgtccttctaccacccgcccggcgagggcaacgaaggatgcgcgacggcccagggtggg
gcagaggatgaaggagaggcagaggcaggttggatcgagggggccgccattctcctctca
gttatctgtgtggtcctggtcacggccttcaatgactggagcaaagagaaacagttccgg
ggcctgcagagccgcatcgagcaggaacagaaatttaccgtggtccgggctggccaggtg
gtccagatccctgtggctgagatcgtggttggggacatagcccaggtcaaatatggtgac
ctcctccctgccgacggcctcttcatccagggcaatgacctcaagattgatgaaagctcc
ctaactggagagtctgaccaggtgcgcaagtccgtggacaaggaccccatgctgctgtca
ggaacccacgtgatggagggctcaggacggatgttggtgactgctgtgggtgtgaactct
cagactggcatcatctttaccctcctgggggctggtggtgaagaggaagagaagaaagac
aaaaaagccaaacagcaggacggggcagccgccatggagatgcagcccctcaagagtgcc
gagggcggcgacgctgacgacaggaagaaggccagcatgcacaagaaggagaagtccgtg
ctgcagggcaagctcaccaagctggctgtgcagatcgggaaggcgggcttggtgatgtca
gccatcacggtgatcatcctggtgctctacttcactgtggacaccttcgtggtcaacaag
aagccgtggctgcctgagtgcacgcccgtctacgtgcagtactttgtcaagttcttcatc
attggcgtgacggtgctggtggtcgccgtgcccgaggggctccctctggccgtcaccatc
tcgttggcctattcggtgaagaaaatgatgaaggacaataacctggtacgccacctggat
gcctgtgagaccatgggcaatgccacagccatctgctcagacaagacaggcacgctgacc
accaatcgcatgacagtggtacaggcctatgtcggcgacgtccactataaagagatcccc
gaccccagctccatcaacaccaagaccatggagctgctggtcaatgccatcgccatcaac
agcgcctacaccaccaagattctgcccccagagaaggagggcgccctgcctcggcaggtg
ggcaacaagacggagtgcggcctgctgggcttcgtgctggacctgaagcaggactacgag
cccgtgcgcagccagatgccagaggagaagctgtacaaagtgtacaccttcaactccgtg
cgcaagtccatgagcactgtcatcaagctgcccgacgagagcttccgcatgtacagcaag
ggggcttctgagatcgtgctcaagaagtgctgcaaaatcctcaatggggcgggagagcct
cgtgtcttccggccccgcgaccgggacgagatggtaaagaaggtgattgagcccatggct
tgcgatgggctccgcactatctgcgtggcctaccgcgacttccccagcagcccggagccg
gactgggacaatgagaatgacatcctcaacgaactcacctgcatctgcgtggtgggcatc
gaggacccagtgcggccagaggtcccagaagccatccgcaagtgccagcgggcaggcatc
acggtccgcatggtcactggcgacaatatcaacacggctcgggccatcgccatcaagtgt
ggcatcatccatcctggggaggactttctgtgcctcgagggcaaggagttcaacaggagg
atccgcaacgagaagggggagattgagcaggagcgaattgacaagatctggccaaagctg
cgggtgctggctcgctcctcccccacggacaagcataccctggttaaaggcatcatcgac
agcacacacactgagcagcggcaggtggtggccgtgacgggggacgggaccaacgacggg
cctgcactcaagaaggccgacgtgggcttcgccatgggcatcgcaggcactgacgtggcc
aaggaggcctcagacatcatcctgacagacgacaatttcagcagcatcgtcaaggcagtg
atgtggggccgcaacgtctatgacagcatctccaaattcttgcagttccagctcaccgtc
aacgtggtggccgtgattgtggccttcacaggcgcctgcatcacgcaggactcccctctg
aaggccgtgcagatgctctgggtgaacctcatcatggacacgtttgcctcgctggcactg
gccactgagccgcccacggagaccctgctgctgaggaagccgtacggccgcaacaagccg
ctcatctccaggaccatgatgaagaacatcctgggccatgctgtctaccagcttgccctc
atcttcaccctgctctttgttggcgagaagatgttccagatcgacagcgggaggaacgcg
cccctgcattcgccaccctcagagcattacaccatcatcttcaacaccttcgtcatgatg
cagctcttcaacgagatcaacgcccgcaagatccacggcgagcgcaatgtctttgacggc
atcttccggaaccccatcttctgcaccatcgtgctgggcacctttgccatccagatagtg
atcgtgcagtttggagggaagccattcagctgctctccactgcagctggaccagtggatg
tggtgcatattcattgggttaggagagctcgtttggggccaggtcatcgccaccatcccg
accagcagactcaagttcctcaaggaggcaggcaggctcacgcagaaggaggagatccca
gaggaggagctgaacgaggacgtggaggagatcgaccacgcggagcgggagctgcggcgg
ggccagatcctgtggttccgaggcctgaatcggatccagacacagatccgcgtcgtgaag
gcgttccgtagctctctctatgaaggtttagaaaagcctgaatctcgaacctccatccat
aacttcatggctcatcctgaattccggatcgaagattcccagccccacatccccctcatt
gatgacaccgacctggaagaagatgccgcgctcaagcagaactcgagcccgccgtcgtcc
ctcaacaagaacaacagcgccatcgacagtgggatcaacctgacgaccgacacaagcaaa
tcagctacctcttcaagtccagggagccccatccacagcctggagacgtcgctttag

KEGG   Pan paniscus (bonobo): 100988724
Entry
100988724         CDS       T02283                                 

Gene name
ATP2B4
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 4
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04925  Aldosterone synthesis and secretion
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04972  Pancreatic secretion
pps04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100988724 (ATP2B4)
   04024 cAMP signaling pathway
    100988724 (ATP2B4)
   04022 cGMP-PKG signaling pathway
    100988724 (ATP2B4)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100988724 (ATP2B4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100988724 (ATP2B4)
  09154 Digestive system
   04970 Salivary secretion
    100988724 (ATP2B4)
   04972 Pancreatic secretion
    100988724 (ATP2B4)
   04978 Mineral absorption
    100988724 (ATP2B4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100988724 (ATP2B4)
Enzymes [BR:pps01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100988724 (ATP2B4)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 100988724
NCBI-ProteinID: XP_003823032
UniProt: A0A2R9C7M1
Position
1
AA seq 1205 aa
MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKT
SPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLS
FYRPAGEENELCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGL
QCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLT
GESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKK
GKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKSVLQGKLTRLA
VQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVA
VPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQA
YIGGIHYRQIPSPDVFLPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALL
GFVTDLKQDYQAVRNEVPEEKLYKVYTFNSVRKSMSTVIRNPNGGFRMYSKGASEIILRK
CNRILDRKGEAVPFKNKDRDDMVRTVIEPMACDGLRTICIAYRDFDDTEPSWDNENEILT
ELTCIAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNINTARAIATKCGILTPGDDFL
CLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGEHRQVV
AVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI
SKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLL
KRRPYGRNKPLISRTMMKNILGHAFYQLIVIFILVFAGEKFFDIDSGRKAPLHSPPSQHY
TIVFNTFVLMQLFNEINSRKIHGEKNVFSGIYRNIIFCSVVLGTFICQIFIVEFGGKPFS
CTSLSLSQWLWCLFIGIGELLWGQFISAIPTRSLKFLKEAGHGTTKEEITKDAEGLDEID
HAEMELRRGQILWFRGLNRIQTQIKVVKAFHSSLHESIQKPYNQKSIHSFMTHPEFAIEE
ELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQS
LETSV
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgacgaacccatcagaccgtgtcttgcctgccaactcgatggccgagagccgtgaaggg
gactttggctgcacagtaatggaactgaggaagctcatggagctgcgttcgagggatgca
ctgacccagattaatgtccactatggaggtgtacagaatctctgcagtagactgaaaacc
tcccctgtggaaggtctgtctgggaaccctgcagatctggagaaacgtaggcaggtgttt
ggacacaacgtgatcccccccaaaaagcccaagactttcttagaattagtgtgggaagct
cttcaagatgtcacgctcatcatcctggagattgcagccatcatctccctggtcctgtcc
ttttatcgccctgctggtgaagaaaatgaactgtgtggtcaagtcgcaactaccccagaa
gatgaaaatgaggcacaagctggctggattgagggggcagccatccttttctcagtgatc
atcgtggtgttagtgactgcctttaatgattggagcaaagagaagcaattccgggggctg
cagtgccgcattgaacaggagcaaaagttctccatcatccgaaacggtcaactcatccag
ctccctgtggctgagattgtggttggtgatattgcccaagtcaaatacggtgatctgctg
cctgcagatggaatcctgatccaagggaatgatctgaagattgatgagagctctctgaca
ggggaatctgaccatgtcaagaagtccctggacaaagaccccatgttgctctcagggacc
catgtcatggaaggttctggccggatggtggtgacagctgttggtgtcaactctcagact
ggaatcatccttactctcttgggggtcaatgaggatgacgaaggggagaaaaagaagaaa
ggtaaaaaacaaggagtccctgaaaatcgcaacaaagcaaagacccaagacggagtggcc
ctggaaatccagccactcaacagccaggagggaatcgacaatgaggaaaaggacaagaag
gcagtcaaggtgcctaaaaaggagaagtcagtgctgcagggcaagctgactcgcctggct
gttcagattgggaaagccggtctgctcatgtctgctctcacggttttcatcctgattcta
tactttgtgattgacaactttgtgataaatcgcagaccatggctccctgagtgtactccc
atctacatccagtactttgtcaagttcttcatcatcggcatcactgtactggtggtggct
gtgccagaggggctgcctttggctgtcaccatctcactggcctactctgtgaagaaaatg
atgaaagacaataacctagtacggcacttggatgcttgtgagaccatgggcaacgccacc
gccatctgctctgataagacaggcacgttgaccatgaaccgcatgactgtggtacaagct
tatattgggggcatccattaccgtcaaatcccaagccctgatgtcttcctgcccaaagtc
ctggacctcattgtcaatggcatttctatcaacagtgcttatacctccaagattctgcct
ccagagaaggagggaggcctgcctcggcaggtgggcaacaagaccgagtgtgctctgcta
ggctttgtcacagatctgaagcaggattatcaggctgtgcgtaatgaagtgcccgaggag
aagctctacaaggtgtacaccttcaactcagtgcgcaagtcaatgagcaccgtcatcagg
aatcccaacggtggcttccgtatgtacagcaagggcgcctctgagatcatcttgcgcaag
tgtaatcgaatcctggaccggaaaggggaagcagtgccattcaagaataaagacagagat
gatatggtacgcactgtcatcgagcccatggcctgtgatggactccggactatctgcata
gcttaccgggacttcgatgacacagagccctcttgggacaatgagaatgagatcctcacc
gaactgacctgtatcgcggtggtgggcattgaggaccctgtgcgcccagaggtgccagat
gctattgccaaatgcaaacaagctggcattactgtcagaatggtgacaggtgacaacatc
aacacagcccgggccattgccaccaaatgtggcattctgacacctggggatgacttcctg
tgcttagaaggcaaagaattcaaccggctcatccgcaacgagaaaggcgaggtagagcaa
gaaaagctggacaagatctggcctaagcttcgggtcctggcgcgatcttctcccactgac
aagcacaccctggtgaaaggcataattgacagcactgttggggaacaccggcaggtcgtg
gctgtcactggtgatggcacaaatgacgggcctgctctgaagaaagcggatgttggtttt
gcaatgggcatcgcaggcacagatgtagcaaaggaggcttcagacatcatcctaacagat
gacaactttaccagcattgtgaaggcagtgatgtggggacgaaatgtctatgacagcatc
tccaagttcctgcagttccagctcactgtcaatgtggtggccgtgattgtagccttcact
ggagcctgtatcactcaggattccccattgaaagctgtgcagatgttgtgggttaatctg
atcatggacacttttgcttcattggccctggccacagagccccctacggaatctctgttg
aagcggcgcccctatggccgaaataagcctctgatctcacgcactatgatgaagaacatc
ttgggccatgcgttctatcagctcattgtcatctttatccttgtctttgcgggtgagaaa
ttctttgatattgatagtgggaggaaggcacctctgcattcaccacccagccagcactat
accattgtttttaacaccttcgtgctgatgcagctcttcaatgaaatcaactcccgaaag
atccatggagagaagaacgtcttttcaggcatctaccgcaacattatcttctgctctgta
gtcttgggcacattcatctgccagattttcatcgtggaatttgggggtaaacccttcagt
tgtacaagcctcagcctgtctcagtggctgtggtgtctcttcattgggattggagaactt
ctgtggggccagttcatctccgcaatacctacccgatccctgaagttcctgaaggaggct
gggcatggcaccaccaaagaggagatcaccaaggatgccgagggactggatgagattgac
catgctgagatggagctgcgccgaggccagatcctctggttccggggcctgaaccgtatc
cagactcagatcaaagtggtcaaagcattccatagttccctccacgaaagcattcagaaa
ccctacaaccaaaagtccatccacagcttcatgacccaccctgaattcgccatagaggag
gagttgccacgaacaccactcctggatgaggaagaggaggaaaatcctgacaaggcttct
aagtttgggactagggtgctcctgttggatggtgaggtcactccatacgccaatacaaac
aacaatgcggtggattgcaaccaagtgcagctcccccagtcggacagctctctacagagc
ctagagacatcggtttga

DBGET integrated database retrieval system