KEGG   Pan paniscus (bonobo): 100973367
Entry
100973367         CDS       T02283                                 

Gene name
PLN
Definition
(RefSeq) phospholamban
  KO
K05852  phospholamban
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04919  Thyroid hormone signaling pathway
pps05414  Dilated cardiomyopathy
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100973367 (PLN)
   04024 cAMP signaling pathway
    100973367 (PLN)
   04022 cGMP-PKG signaling pathway
    100973367 (PLN)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100973367 (PLN)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100973367 (PLN)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100973367 (PLN)
   05415 Diabetic cardiomyopathy
    100973367 (PLN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100973367 (PLN)
Transporters [BR:pps02000]
 Other transporters
  Pores ion channels [TC:1]
   100973367 (PLN)
SSDB
Motif
Pfam: Phospholamban Sarcolipin
Other DBs
NCBI-GeneID: 100973367
NCBI-ProteinID: XP_003827634
UniProt: A0A2R8ZJ06
Position
6
AA seq 52 aa
MEKVQHLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
NT seq 159 nt   +upstreamnt  +downstreamnt
atggagaaagtccaacacctcactcgctcagctataagaagagcctcaaccattgaaatg
cctcaacaagcacgtcaaaagctacagaatctatttatcaatttctgtctcatcttaata
tgtctcttgctgatctgtatcatcgtgatgcttctctga

DBGET integrated database retrieval system