KEGG   Pan paniscus (bonobo): 100973516
Entry
100973516         CDS       T02283                                 

Gene name
AREG
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04390  Hippo signaling pathway
pps05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100973516 (AREG)
   04012 ErbB signaling pathway
    100973516 (AREG)
   04390 Hippo signaling pathway
    100973516 (AREG)
   04151 PI3K-Akt signaling pathway
    100973516 (AREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    100973516 (AREG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pps03110]
    100973516 (AREG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100973516 (AREG)
Chaperones and folding catalysts [BR:pps03110]
 Intramolecular chaperones
  Others
   100973516 (AREG)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100973516 (AREG)
SSDB
Motif
Pfam: FtsL EGF
Other DBs
NCBI-GeneID: 100973516
NCBI-ProteinID: XP_003832370
UniProt: A0A2R9CBP5
Position
4
AA seq 252 aa
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSELSSGADYDYSEEYDNELQIPGYIVDDSVRVEQVVKPPKNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAIAVITVQLRRRYVRKYEGEAEERKK
LRQENGNVHAIA
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagagccccgctgctaccgccggcgccggtggtgctgtcgctcttgatactcggctca
ggccattatgctgctggattggacctcaatgacacctactctgggaagcgtgaaccattt
tctggggaccacagtgctgatggatttgaggttacctcaagaagtgagatgtcttcagga
agtgagatttcccctgtgagtgaaatgccttctagtagtgaactgtcctcgggagccgac
tatgactactcagaagagtatgataacgaactacaaatacctggctatattgtcgatgat
tcagtcagagttgaacaggtagttaagcccccgaaaaacaagacggaaagtgaaaatact
tcagataaacccaaaagaaagaaaaagggaggcaaaaatggaaaaaatagaagaaacaga
aagaagaaaaatccatgtaatgcagaatttcaaaatttctgcattcacggagaatgcaaa
tatatagagcacctggaagcagtaacatgcaaatgtcagcaagaatatttcggtgaacgg
tgtggggaaaagtccatgaaaactcacagcatgattgacagtagtttatcaaaaattgca
ttagcagccatagctgcctttatgtctgctgtgatcctcacagctattgctgttattaca
gtccagcttagaagacgatacgtcaggaaatatgaaggagaagctgaggaacgaaagaaa
cttcgacaagagaatggaaatgtacatgctatagcataa

DBGET integrated database retrieval system