KEGG   Pan paniscus (bonobo): 100973549
Entry
100973549         CDS       T02283                                 

Gene name
BCL2L11
Definition
(RefSeq) BCL2 like 11
  KO
K16341  Bcl-2-like protein 11
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04068  FoxO signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04932  Non-alcoholic fatty liver disease
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100973549 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    100973549 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100973549 (BCL2L11)
   04215 Apoptosis - multiple species
    100973549 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100973549 (BCL2L11)
   05206 MicroRNAs in cancer
    100973549 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100973549 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100973549 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100973549 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100973549 (BCL2L11)
SSDB
Motif
Pfam: Bim_N Bclx_interact
Other DBs
NCBI-GeneID: 100973549
NCBI-ProteinID: XP_003804755
UniProt: A0A2R9CA30
Position
2A
AA seq 198 aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
MVILRLLRYIVRLVWRMH
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcaaagcaaccttctgatgtaagttctgagtgtgaccgagaaggtagacaattgcag
cctgcggagaggcctccccagctcagacctggggcccctacctccctacagacagagcca
caaggtaatcctgaaggcaatcacggaggtgaaggggacagctgcccccacggcagccct
cagggcccgctggccccaccggccagccctggcccttttgctaccagatccccgcttttc
atctttatgagaagatcctccctgctgtctcgatcctccagtgggtatttctcttttgac
acagacaggagcccagcacccatgagttgtgacaaatcaacacaaaccccaagtcctcct
tgccaggccttcaaccactatctcagtgcaatggcttccatgaggcaggctgaacctgca
gatatgcgcccggagatatggatcgcccaagagttgcggcgtatcggagacgagtttaac
gcttactatgcaaggagggtatttttgaataattaccaagcagccgaagaccacccacga
atggttatcttacgactgttacgttacattgtccgcctggtgtggagaatgcattga

DBGET integrated database retrieval system