KEGG   Pan paniscus (bonobo): 100973837
Entry
100973837         CDS       T02283                                 

Gene name
RB1
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04110  Cell cycle
pps04218  Cellular senescence
pps04934  Cushing syndrome
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05207  Chemical carcinogenesis - receptor activation
pps05212  Pancreatic cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100973837 (RB1)
   04218 Cellular senescence
    100973837 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100973837 (RB1)
   05207 Chemical carcinogenesis - receptor activation
    100973837 (RB1)
   05203 Viral carcinogenesis
    100973837 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100973837 (RB1)
   05225 Hepatocellular carcinoma
    100973837 (RB1)
   05226 Gastric cancer
    100973837 (RB1)
   05214 Glioma
    100973837 (RB1)
   05220 Chronic myeloid leukemia
    100973837 (RB1)
   05218 Melanoma
    100973837 (RB1)
   05219 Bladder cancer
    100973837 (RB1)
   05215 Prostate cancer
    100973837 (RB1)
   05224 Breast cancer
    100973837 (RB1)
   05222 Small cell lung cancer
    100973837 (RB1)
   05223 Non-small cell lung cancer
    100973837 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100973837 (RB1)
   05161 Hepatitis B
    100973837 (RB1)
   05160 Hepatitis C
    100973837 (RB1)
   05163 Human cytomegalovirus infection
    100973837 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100973837 (RB1)
   05169 Epstein-Barr virus infection
    100973837 (RB1)
   05165 Human papillomavirus infection
    100973837 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100973837 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100973837 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100973837 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100973837 (RB1)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100973837 (RB1)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    100973837 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 TFIIB
Other DBs
NCBI-GeneID: 100973837
NCBI-ProteinID: XP_003811470
Position
13
AA seq 928 aa
MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL
CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTEL
QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS
ISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYK
TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS
NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccgaaaaacggccgccaccgccgccgctgccgccgcggaaccc
ccggcaccgccgccgccgccccctcctgaggaggacccagagcaggacagcggcccggag
gacctgcctctcgtcaggcttgagtttgaagaaacagaagaacctgattttactgcgtta
tgtcagaaattaaagataccagatcatgtcagagagagagcttggttaacttgggagaaa
gtttcatctgtggatggagtattgggaggttatattcaaaagaaaaaggaactgtgggga
atctgtatctttattgcagcagttgacctagatgagatgtcgttcacttttactgagcta
cagaaaaacatagaaatcagtgtccataaattctttaacttactaaaagaaattgatacc
agtaccaaagttgataatgctatgtcaagactgttgaagaagtatgatgtattgtttgca
ctcttcagcaaattggaaaggacatgtgaacttatatatttgacacaacccagcagttcg
atatctactgaaataaattctgcattggtgctaaaagtttcttggatcacatttttatta
gctaaaggggaagtattacaaatggaagatgatctggtgatttcatttcagttaatgcta
tgtgtccttgactattttattaaactctcacctcccatgttgctcaaagaaccatataaa
acagctgttatacccattaatggttcacctcgaacacccaggcgaggtcagaacaggagt
gcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaa
catgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatg
aattctcttggacttgtaacatctaatggacttccagaggttgaaaatctttctaaacga
tacgaagaaatttatcttaaaaataaagatctagatgcaagattatttttggatcatgat
aaaactcttcagactgattctatagacagttttgaaacacagagaacaccacgaaaaagt
aaccttgatgaagaggtgaatgtaattcctccacacactccagttaggactgttatgaac
actatccaacaattaatgatgattttaaattcagcaagtgatcaaccttcagaaaatctg
atttcctattttaacaactgcacagtgaatccaaaagaaagtatactgaaaagagtgaag
gatataggatacatctttaaagagaaatttgctaaagctgtgggacagggttgtgtcgaa
attggatcacagcgatacaaacttggagttcgcttgtattaccgagtaatggaatccatg
cttaaatcagaagaagaacgattatccattcaaaattttagcaaacttctgaatgacaac
atttttcatatgtctttattggcgtgcgctcttgaggttgtaatggccacatatagcaga
agtacatctcagaatcttgattctggaacagatttgtctttcccatggattctgaatgtg
cttaatttaaaagcctttgatttttacaaagtgatcgaaagttttatcaaagcagaaggc
aacttgacaagagaaatgataaaacatttagaacgatgtgaacatcgaatcatggaatcc
cttgcatggctctcagattcacctttatttgatcttattaaacaatcaaaggaccgagaa
ggaccaactgatcaccttgaatctgcttgtcctcttaatcttcctctccagaataatcac
actgcagcagatatgtatctttctcctgtaagatctccaaagaaaaaaggttcaactacg
cgtgtaaattctactgcaaatgcagagacacaagcaacctcagccttccagacccagaag
ccattgaaatctacctctctttcactgttttataaaaaagtgtatcggctagcctatctc
cggctaaatacactttgtgaacgccttctgtctgagcacccagaattagaacatatcatc
tggacccttttccagcacaccctgcagaatgagtatgaactcatgagagacaggcatttg
gaccaaattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaa
ttcaaaatcattgtaacagcatacaaggatcttcctcatgctgttcaggagacattcaaa
cgtgttttgatcaaagaagaggagtatgattctattatagtattctataactcggtcttc
atgcagagactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtca
ccaatacctcacattcctcgaagcccttacaagtttcctagttcacccttacggattcct
ggagggaacatctatatttcacccctgaagagtccatataaaatttcagaaggtctgcca
acaccaacaaaaatgactccaagatcaagaatcttagtatcaattggtgaatcattcggg
acttctgagaagttccagaaaataaatcagatggtatgtaacagcgaccgtgtgctcaaa
agaagtgctgaaggaagcaaccctcctaaaccactgaaaaaactacgctttgatattgaa
ggatcagatgaagcagatggaagtaaacatctcccaggagagtccaaatttcagcagaaa
ctggcagaaatgacttctactcgaacacgaatgcaaaagcagaaaatgaatgatagcatg
gatacctcaaacaaggaagagaaatga

DBGET integrated database retrieval system