KEGG   Pan paniscus (bonobo): 100973869
Entry
100973869         CDS       T02283                                 

Gene name
EREG
Definition
(RefSeq) epiregulin
  KO
K09784  epiregulin
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04151  PI3K-Akt signaling pathway
pps05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100973869 (EREG)
   04012 ErbB signaling pathway
    100973869 (EREG)
   04151 PI3K-Akt signaling pathway
    100973869 (EREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    100973869 (EREG)
SSDB
Motif
Pfam: EGF BCCT CD34_antigen Sigma_reg_N
Other DBs
NCBI-GeneID: 100973869
NCBI-ProteinID: XP_003832371
Position
4
AA seq 163 aa
MEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRVAQVSIT
KCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVALTVILI
ILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
NT seq 492 nt   +upstreamnt  +downstreamnt
atggagatgctctgtgccggcagggtccctgcgctgctgctctgcctgggtttccatctt
ctacaggcagtcctcagtacaactgtgattccatcatgtatcccaggagagtccagtgat
aactgtacagctttagttcagacagaagacaatccacgtgtggctcaagtgtcaataaca
aagtgtagctctgacatgaatggctactgtttgcatggacagtgcatctacctggtggac
atgagtcaaaactactgcaggtgtgaagtgggttatactggtgtccgatgtgaacacttc
tttttaaccgtccaccaacctttaagcaaagaatatgtggctttgaccgtgattcttatt
attttgtttcttatcacagtcgtcggttccacatattatttctgcagatggtacagaaat
cgaaaaagtaaagaaccaaagaaggaatatgagagagttacctcaggggatccagagttg
ccgcaagtctga

DBGET integrated database retrieval system