KEGG   Pan paniscus (bonobo): 100974638
Entry
100974638         CDS       T02283                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase 3
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00220  Arginine biosynthesis
pps00330  Arginine and proline metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04066  HIF-1 signaling pathway
pps04071  Sphingolipid signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04370  VEGF signaling pathway
pps04371  Apelin signaling pathway
pps04611  Platelet activation
pps04915  Estrogen signaling pathway
pps04921  Oxytocin signaling pathway
pps04926  Relaxin signaling pathway
pps04931  Insulin resistance
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100974638 (NOS3)
   00330 Arginine and proline metabolism
    100974638 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100974638 (NOS3)
   04371 Apelin signaling pathway
    100974638 (NOS3)
   04066 HIF-1 signaling pathway
    100974638 (NOS3)
   04020 Calcium signaling pathway
    100974638 (NOS3)
   04071 Sphingolipid signaling pathway
    100974638 (NOS3)
   04022 cGMP-PKG signaling pathway
    100974638 (NOS3)
   04151 PI3K-Akt signaling pathway
    100974638 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100974638 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100974638 (NOS3)
   04921 Oxytocin signaling pathway
    100974638 (NOS3)
   04926 Relaxin signaling pathway
    100974638 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100974638 (NOS3)
   05418 Fluid shear stress and atherosclerosis
    100974638 (NOS3)
   05415 Diabetic cardiomyopathy
    100974638 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100974638 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100974638 (NOS3)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100974638 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF6285
Other DBs
NCBI-GeneID: 100974638
NCBI-ProteinID: XP_008966187
Position
7
AA seq 1203 aa
MGNLKSVAQESGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLT
QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPXPPAP
EQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPP
ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW
KGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA
RDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP
PPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE
PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT
NSP
NT seq 3612 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtggcccaggagtctgggccaccctgcggcctggggctgggg
ctgggccttgggctgtgcggcaagcagggcccagccaccccggcccctgagcccagccgg
gccccagcatccctactcccgccagcgccagaacacagccccccgagctccccgctaacc
cagcccccagaggggcccaagttccctcgtgtgaagaactgggaggtggggagcatcacc
tatgacaccctcagcgcccaggcgcagcaggatgggccctgcaccccaagacgctgcctg
ggctccctggtatttccacggaaactacagggccggccctccccgnngcccccggcccct
gagcagctgctgagtcaggcccgggacttcatcaaccagtactacagctccattaagagg
agcggctcccaggcccacgaacagcggcttcaagaggtggaagccgaggtggcagccaca
ggcacctaccagcttagggagagcgagctggtgttcggggccaagcaggcctggcgcaac
gctccccgctgcgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggac
tgcaggtctgcacaggaaatgttcacctacatctgcaaccacatcaagtatgccaccaac
cggggcaaccttcgctcggccatcacagtgttcccgcagcgctgccctggccgaggagac
ttccgaatctggaacagccagctggtgcgctacgcgggctaccggcagcaggacggctct
gtgcggggggacccagccaacgtggagatcaccgagctctgcattcagcacggctggacc
ccaggaaacggtcgcttcgacgtgctgcccctgctgctgcaggccccagatgagccccca
gaactcttccttctgccccccgagctggtccttgaagtgcccctggagcaccccacgctg
gagtggtttgcagccctgggcctgcgctggtacgccctcccagcagtgtccaacatgctg
ctggaaattgggggcctggagttccccgcagcccccttcagtggctggtacatgagcact
gagatcggcacgaggaacctgtgtgaccctcaccgctacaacatcctggaggatgtggct
gtctgcatggacctggatacccggacaacctcgtccctgtggaaagacaaggcagcagtg
gaaatcaacgtggccgtgctgcacagttaccagctggccaaagtcaccatcgtggaccac
cacgccgccacggcctctttcatgaagcacctggagaatgagcagaaggccagggggggc
tgccctgcagactgggcctggatcgtgccccccatctcgggcagcctcactcctgttttc
catcaggagatggtcaactatttcctgtccccggccttccgctaccagccagacccctgg
aaggggagtgccgccaagggcaccggcatcaccaggaagaagacctttaaagaagtggcc
aacgccgtgaagatctccgcctcgctcatgggcacggtgatggcgaagcgagtgaaggcg
acaatcttgtatggctccgagaccggccgggcccagagctacgcacagcagctggggaga
ctcttccggaaggcttttgatccccgggtcctgtgtatggatgagtatgacgtggtgtcc
ctcgaacacgagacgctggtgctggtggtaaccagcacatttgggaatggggatcccccg
gagaatggagagagctttgcagctgccctgatggagatgtccggcccctacaacagctcc
cctcggccggaacagcacaagagttataagatccgcttcaacagcatctcctgctcagac
ccactggtgtcctcttggcggcggaagaggaaggagtccagtaacacagacagtgcaggg
gccctgggcaccctcaggttctgtgtgttcgggctcggctcccgggcatacccccacttc
tgcgcctttgctcgtgcggtggacacacggctggaggaactgggcggggagcggctgctg
cagctgggccagggcgacgagctgtgcggccaggaggaggccttccgaggctgggcccag
gctgccttccaggccgcctgtgagaccttctgtgtgggagaggatgccaaggccgccgcc
cgagacatcttcagccccaaacggagctggaagcgccagaggtaccggctgagcgcccag
gccgagggcctgcagttgctgccaggtctgatccacgtgcacaggcggaagatgttccag
gctacaatccgctcagtggaaaacctgcaaagcagcaagtccacgagggccaccatcctg
gtgcgcctggacaccggaggccaggaggggctgcagtaccagccgggggaccacataggt
gtctgcccgcccaaccggcccggccttgtggaggcgctgctgagccgcgtggaggacccg
ccggcgcccactgagcccgtggcagtagagcagctggagaagggcagccctggtggccct
ccccccggctgggtgcgggacccccggctgcccccgtgcacgctgcgccaggctctcacc
ttcttcctggacatcacctccccacccagccctcagctcttgcggctgctcagcaccttg
gcagaagagcccagggaacagcaggagctggaggccctcagccaggatccccgacgctac
gaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttcccgtcg
gtggcgctgcctgccccactgctcctcacccagctgcctctgctccagccccggtactac
tcagtcagctcggcacccagcacccacccaggagagatccacctcactgtagctgtgctg
gcatacaggactcaggatgggctgggccccctgcactatggagtctgctccacgtggcta
agccagctcaagcccggagaccctgtgccctgcttcatccggggggctccctccttccgg
ctgccacccgatcccagcttgccctgcatcctagtgggcccaggcactggcattgccccc
ttccggggattctggcaggagcggctgcatgacattgagagcaaagggctgcagcccact
cccatgactttggtgttcggctgccgatgctcccaacttgaccatctctaccgcgacgag
gtgcagaacgcccagcagcgcggggtgtttggccgagtcctcaccgccttctcccgggaa
cctgacaaccccaagacctacgtgcaggacatcctgaggacggagctggctgcggaggtg
caccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgtcaccatggca
accaacgtcctgcagaccgtgcagcgcatcctggcgacggagggcgacatggagctggac
gaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaagacattttc
gggctcacgctgcgcacccaggaggtgacaagccgcatacgcacccagagcttttccttg
caggagcgtcagttgcggggcgcagtgccctgggcgttcgaccctcccggctcagacacc
aacagcccctga

KEGG   Pan paniscus (bonobo): 100976546
Entry
100976546         CDS       T02283                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00220  Arginine biosynthesis
pps00330  Arginine and proline metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04066  HIF-1 signaling pathway
pps04146  Peroxisome
pps04371  Apelin signaling pathway
pps04926  Relaxin signaling pathway
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05022  Pathways of neurodegeneration - multiple diseases
pps05133  Pertussis
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05200  Pathways in cancer
pps05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100976546 (NOS2)
   00330 Arginine and proline metabolism
    100976546 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100976546 (NOS2)
   04066 HIF-1 signaling pathway
    100976546 (NOS2)
   04020 Calcium signaling pathway
    100976546 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100976546 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100976546 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100976546 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100976546 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100976546 (NOS2)
   05152 Tuberculosis
    100976546 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100976546 (NOS2)
   05145 Toxoplasmosis
    100976546 (NOS2)
   05140 Leishmaniasis
    100976546 (NOS2)
   05142 Chagas disease
    100976546 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100976546 (NOS2)
   05014 Amyotrophic lateral sclerosis
    100976546 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    100976546 (NOS2)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100976546 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 100976546
NCBI-ProteinID: XP_008963431
Position
17
AA seq 1152 aa
MREGLGAACEAAGPRLCRLLCRILRPKPDCCPRRASPVTQDDLQYHNLSKQQNESPQPLV
ETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMT
PKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQL
TGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNIR
SAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYGR
FDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVGG
LEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINIA
VLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEML
NYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVTI
LFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPGN
GEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGDE
LSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLS
KALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQP
ALVQGILERVVDGPTPHQTVHLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQL
LLQKLAQVATEATERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQLP
ILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCFV
RNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPDE
DHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLYV
CGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDRV
AVQPSNLEMSAL
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgcgcgaggggctgggcgcggcgtgcgaggccgccgggccccggctgtgtaggctgctc
tgcaggatcctccggccgaagcctgactgctgcccgcgcagagccagtccagtgacacag
gatgaccttcagtatcacaacctcagcaagcagcagaatgagtccccgcagcccctcgtg
gagacgggaaagaagtctccagaatctctggtcaagctggatgcaaccccattgtcctcc
ccacggcatgtgaggatcaaaaactggggcagcgggatgactttccaagacacacttcac
cataaagccaaagggattttaacttgcaggtccaaatcttgcctggggtccattatgact
cccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttctacct
caagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagaggaa
catctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccaactg
acgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgcatt
gggaggatccagtggtccaacctgcaggtcttcgatgcccgcagctgttccactgcccgg
gaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatcagg
tcggccatcaccgtgttcccccagcggagtgatggcaagcacgacttccgggtgtggaat
gctcagctcatccgctatgctggctaccagatgccagatggcagcatcagaggggaccct
gccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtacggccgc
ttcgatgtggtccccctggtcctgcaggccaatggccgtgaccctgagctcttcgaaatc
ccacctgaccttgtgcttgaggtggccatggaacatcccaaatacgagtggtttcgggaa
ctggagctaaagtggtacgccctgcctgcagtggccaacatgctgcttgaggtgggcggc
ctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtccgg
gacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggcttg
gaaacgcacaagctggcctcgctctggaaagaccaggctgtcgttgagatcaacattgct
gtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcggctgcagaa
tccttcatgaagtacatgcagaatgaataccggtcccgtgggggctgcccggcagactgg
atttggctggtccctcccatgtctgggagcatcacccccgtgtttcaccaggagatgctg
aactatgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtctgg
caggacgagaagcggagacccaagagaagagagattccattgaaagtcttggtcaaagct
gtgctctttgcctgtatgctgatgcgcaagacaatggcgtcccgagtcagagtcaccatc
ctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggccttgttc
agctgtgccttcaaccccaaggttgtctgcatggataagtacaggctgagctgcctggag
gaggagcggctgctgttggtggtgaccagtacgtttggcaatggagactgccccggcaat
ggagagaaactgaagaaatcgctcttcatgctgaaagagctcaacaacaaattcaggtac
gctgtgtttggcctcggctccagcatgtaccctcggttctgcgcctttgctcatgacatt
gatcagaagctgtcccacctgggggcctctcagctcaccccgatgggagaaggggatgag
ctcagtgggcaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcctgt
gagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctccaat
gtgacctgggacccgcaccactacaggctcgtgcaggactcacagcctttggacctcagc
aaagccctcagcagcatgcatgccaagaacgtgttcaccatgaggctcaaatctcggcag
aatctacaaagtccgacatccagccgtgccaccatcctggtggaactctcctgtgaggat
ggccaaggcctgaactacctgccgggggagcaccttggggtttgcccaggcaaccagccg
gccctggtccaaggcatcctggagcgagtggtggatggccccacaccccaccagacagtg
cacctggaggccctggatgagagtggcagctactgggtcagtgacaagaggctgcccccc
tgctcactcagccaggccctcacctacttcctggacatcaccacacccccaacccagctg
ctgctccaaaagctggcccaggtggccacagaagcgactgagagacagaggctggaggcc
ctttgccagccctcagagtacagcaagtggaagttcaccaacagccccacattcctggag
gtgctagaggagttcccgtccctgcgggtgtctgctggcttcctgctttcccagctcccc
attctgaagcccaggttctactccatcagctcctcccgggatcacacgcccacggagatc
cacctgactgtggccgtggtcacctaccacacccgagatggccagggtcccctgcaccac
ggcgtctgcagcacatggctcaacagcctgaagccccaagacccagtgccctgctttgtg
cggaatgccagcggcttccacctccccgaggatccctcccatccttgcatcctcatcggg
cctggcacaggcatcgcgcccttccgcagtttctggcagcaacggctccatgactcccag
cacaagggagtgcggggaggccgcatgaccttggtgtttgggtgccgccgcccagatgag
gaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgcggtg
cacacagcctattcccgcctgcctggcaagcccaaggtctatgttcaggacatcctgcgg
cagcagctggccagcgaggtgctccgtgtgctccacaaggagccaggccacctctatgtt
tgcggggatgtgcgcatggcccgggacgtggcccataccctgaagcagctggtggctgcc
aagctgaaattgaatgaggagcaggtcgaggactatttctttcagctcaagagccagaag
cgctatcacgaagatatctttggtgctgtatttccctacgaggcgaagaaggacagggtg
gcggtgcagcccagcaacctggagatgtcagcgctctga

KEGG   Pan paniscus (bonobo): 100996089
Entry
100996089         CDS       T02283                                 

Gene name
NOS1
Definition
(RefSeq) nitric oxide synthase 1
  KO
K13240  nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00220  Arginine biosynthesis
pps00330  Arginine and proline metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04145  Phagosome
pps04371  Apelin signaling pathway
pps04713  Circadian entrainment
pps04730  Long-term depression
pps04926  Relaxin signaling pathway
pps04970  Salivary secretion
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100996089 (NOS1)
   00330 Arginine and proline metabolism
    100996089 (NOS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100996089 (NOS1)
   04020 Calcium signaling pathway
    100996089 (NOS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100996089 (NOS1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100996089 (NOS1)
  09154 Digestive system
   04970 Salivary secretion
    100996089 (NOS1)
  09156 Nervous system
   04730 Long-term depression
    100996089 (NOS1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100996089 (NOS1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100996089 (NOS1)
   05014 Amyotrophic lateral sclerosis
    100996089 (NOS1)
   05022 Pathways of neurodegeneration - multiple diseases
    100996089 (NOS1)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100996089 (NOS1)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 PDZ PDZ_6 PDZ_2 Flavodoxin_5
Other DBs
NCBI-GeneID: 100996089
NCBI-ProteinID: XP_003832698
UniProt: A0A2R9CL02
Position
12
AA seq 1403 aa
MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPPTKAVDLSHQPSAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP
RPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQV
DRDLDGKSHKPLPLAVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPASGKQSPTKNGSPS
KCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKEQLF
PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIETTSTYQLKDTELIYGAKHAWRNASRC
VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVW
NSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQ
IPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV
RDYCDNSRYNILEEVAKKMNLDMRKMSSLWKDQALVEINIAVLYSFQPDPWNTHVWKGTN
GTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHA
FDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKY
PEPLRFFPRKGPPLPNGDTEVHGLAAARDSQHRSYKVRFNSVSSYSDSQKSSGDGPDLRD
NFESAGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEA
FRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTFVAEAPELTQGLSN
VHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNA
LIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTP
LQLQQFASLATSEKEKQRLLVLSKGLQEYEEWKWGKNPTIVEVLEEFPSIQMPATLLLTQ
LSLLQPRYYSISSSPDMYPDEVHLTVAIVSYRTRDGEGPIHHGVCSSWLNRIQADELVPC
FVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQS
KIDHIYREETLQAKNKGVFRELYTAYSREPDKPKKYVQDILQEQLAESVYRALKEQGGHI
YVCGDVTMAADVLKAIQRIMTQQGKLSAEDAGVFISRMRDDNRYHEDIFGVTLRTYEVTN
RLRSESIAFIEESKKDPDEVFSS
NT seq 4212 nt   +upstreamnt  +downstreamnt
atggaggatcacatgttcggtgttcagcaaatccagcccaatgtcatttctgttcgtctc
ttcaagcgcaaagttgggggcctgggattcctggtgaaggagcgggtcagtaagccgccc
gtgattatctctgacctgattcgtgggggcgccgcagagcagagtggcctcatccaggcc
ggagacatcattcttgcggtcaacggccggcccttggtggacctgagctatgacagcgcc
ctggaggtactcagaggcattgcctccgagacccacgtggtcctcattctgaggggtcct
gaaggtttcaccacgcacctggagaccacctttacaggtgatgggacccccaagaccatc
cgggtgacacagcccctgggtccccccaccaaagccgtggatctgtcccaccagccatcg
gccggcaaagaacagccgctggcagtggatggggcctcgggtcccgggaatgggcctcag
catgcctacgatgacgggcaggaggctggctcactcccccatgccaacggcctggccccc
aggcccccaggccaggaccctgcgaagaaagcaaccagagtcagcctccaaggcagaggg
gagaacaatgaactgctcaaggagatagagcctgtgctgagccttctcaccagtgggagc
agaggggtcaagggaggggcacctgccaaggcagagatgaaagatatgggaatccaggtg
gacagagatttggacggcaagtcacacaaacctctgcccctcgccgtggagaatgaccga
gtcttcaatgacctatgggggaagggcaatgtgcctgtcgtcctcaacaacccatattca
gagaaggagcagccccctgcctcaggaaaacagtcccccacaaagaatggcagcccctcc
aagtgtccacgcttcctcaaggtcaagaactgggagactgaggtggttctcactgacacc
ctccaccttaagagcacattggaaacgggatgcactgagtacatctgcatgggctccatc
atgcatccttctcagcatgcaaggaggcctgaagatgtccgcacaaaagaacagctcttc
cctctcgccaaagagtttattgatcaatactattcatcaattaaaagatttggctccaaa
gcccacatggaaaggctggaagaggtgaacaaagagatcgaaaccactagcacctaccag
ctcaaggacacagagctcatctatggggccaagcacgcctggcggaatgcctcgcgctgt
gtgggcaggatccagtggtccaagctgcaggtattcgatgcccgtgactgcaccacggcc
cacgggatgttcaactacatctgtaaccacgtcaagtatgccaccaacaaagggaacctc
aggtccgccatcaccatattcccccagaggacagacggcaagcacgacttccgagtctgg
aactcccagctcatccgctatgctggctacaagcagcccgacggctccaccctgggggac
ccagccaatgtgcagttcacagagatatgcatacagcagggctggaaaccgcctagaggc
cgcttcgatgtcctgccgctcctgcttcaggccaacggcaatgaccctgagctcttccag
attcctccagagctggtgttggaagttcccatcaggcaccccaagtttgagtggttcaag
gacctggggctgaagtggtacggcctccccgccgtgtccaacatgctcctagagattggc
ggcctggagttcagcgcctgtcccttcagtggctggtacatgggcacagagattggtgtc
cgcgactactgtgacaactcccgctacaatatcctggaggaagtggccaagaagatgaac
ttagacatgaggaagatgtcctccctgtggaaggaccaggcgctggtggagatcaatatc
gcggttctctacagcttccagcctgatccctggaacacgcatgtctggaaaggcaccaac
gggacccccacaaagcggcgagccatcggcttcaagaagctagcagaagctgtcaagttc
tcggccaagctgatggggcaggctatggccaagagggtcaaagcgaccatcctctatgcc
acagagacaggcaaatcgcaagcttatgccaagaccttgtgtgagatcttcaaacacgcc
tttgatgccaaggtgatgtccatggaagaatatgacatcgtgcacctggaacatgaaact
ctggtcctcgtggtcaccagcacctttggcaatggagatccccctgagaatggggagaaa
ttcggctgtgctttgatggaaatgaggcaccccaactctgtgcaggaagaaaggaagtac
ccggaacccttgcgtttctttccccgtaaagggcctcccctccccaatggtgacacagaa
gtccacggtctggctgcagcccgtgacagccagcacaggagctacaaggtccgattcaac
agcgtctcctcctactctgactcccaaaaatcatcaggcgatgggcccgacctcagagac
aactttgagagtgctggacccctggccaatgtgaggttctcagtttttggcctcggctca
cgagcataccctcacttttgtgccttcggacacgctgtggacaccctcctggaagaactg
ggaggggagaggatcctgaagatgagggaaggggatgagctctgtgggcaggaagaggct
ttcaggacctgggccaagaaggtcttcaaggcagcctgtgatgtcttctgtgtgggagat
gatgtcaacattgaaaaggccaacaattccctcatcagcaatgatcgcagctggaagaga
aacaagttccgcctcacctttgtggccgaagctccagaactcacacaaggtctatccaat
gtccacaaaaagcgagtctcagctgcccggctccttagccgtcaaaacctccagagccct
aaatccagtcggtcaactatcttcgtgcgtctccacaccaacgggaaccaggagctgcag
taccagcctggggaccacctgggtgtcttccctggcaaccacgaggacctcgtgaatgcc
ctgatcgagcggctggaggacgcgccccctgtcaaccagatggtgaaagtggaactgctg
gaggagcggaacacggctttaggtgtcatcagtaactggacagatgagctccgcctcccg
ccctgcaccatcttccaggccttcaagtactacctggacatcaccacgccaccaacgccc
ctgcagctgcagcagtttgcctccctagctaccagcgagaaggagaagcagcgtctgctg
gtcctcagcaagggtttgcaggagtacgaggaatggaaatggggcaagaaccccaccatc
gtggaggtgctggaggaattcccatctatccagatgccggccaccctgctcctgacccag
ctgtccctgctgcagccccgctactattccatcagctcctccccagacatgtaccctgat
gaagtgcacctcactgtggccatcgtttcctaccgcactcgagatggagaaggaccaatt
caccacggcgtatgctcctcctggctcaaccggatacaggctgacgaactggtcccctgt
ttcgtgagaggagcacccagcttccacctgccccggaacccccaagtcccctgcatcctc
gttggaccaggcaccggcattgcccctttccgaagcttctggcaacagcggcaatttgat
atccaacacaaaggaatgaacccctgccccatggtcctggtcttcgggtgccggcaatcc
aagatagatcatatctacagggaagagaccctgcaggccaagaacaagggggtcttcaga
gagctgtacacggcttactcccgggagccagacaaaccaaagaagtatgtgcaggacatc
ctgcaggagcagctggcggagtctgtgtaccgagccctgaaggagcaagggggccacata
tacgtctgtggggacgtcaccatggctgctgatgtcctcaaagccatccagcgcatcatg
acccagcaggggaagctctcggcagaggacgccggcgtattcatcagccggatgagggat
gacaaccgataccatgaggatatttttggagtcaccctgcgaacgtacgaagtgaccaac
cgccttagatctgagtccattgccttcattgaagagagcaaaaaagaccccgatgaggtt
ttcagctcctaa

DBGET integrated database retrieval system