KEGG   Pan paniscus (bonobo): 100974667
Entry
100974667         CDS       T02283                                 

Gene name
MYLK3
Definition
(RefSeq) myosin light chain kinase 3
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04510  Focal adhesion
pps04611  Platelet activation
pps04810  Regulation of actin cytoskeleton
pps04921  Oxytocin signaling pathway
pps04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100974667 (MYLK3)
   04020 Calcium signaling pathway
    100974667 (MYLK3)
   04022 cGMP-PKG signaling pathway
    100974667 (MYLK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100974667 (MYLK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100974667 (MYLK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100974667 (MYLK3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100974667 (MYLK3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100974667 (MYLK3)
  09154 Digestive system
   04971 Gastric acid secretion
    100974667 (MYLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100974667 (MYLK3)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100974667 (MYLK3)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100974667 (MYLK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like Kdo APH XhlA TCAD9
Other DBs
NCBI-GeneID: 100974667
NCBI-ProteinID: XP_003819839
UniProt: A0A2R9A0B7
Position
16
AA seq 819 aa
MSGTSKESLGHGGLPGLGKACLTTMDKKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHL
ERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDVAQHGARLEALFRMVAA
VDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGV
QSDAREPGEESQKADVLEGTVERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHL
PLPTKVEAKAPETPSENLRTGLELAPAPGRVNVVSPSLEVAPGAGQGASSSRPDPEPLEE
GTRLTPGPGPQCPGPPGLPAQARAAHSGGETPPRISIHIQEMDTPGEMLMTGRGSLGPTL
TTEAPAAAQPGKQGPPGTGRCLQAPGTEPGEQTPEGARELSPLQESSSPGGVKAEEEQRA
GAEPGTRPSLARSDDNDHEVGALGLQQGKSPGAGNPEPEQDCAARAPVRAEAVRRTPPGA
EAGSVVLDDSPAPPAPFEHRVVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLP
LAAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDR
ITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLA
RRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAET
MNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLNNLPAKASRS
KTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTSP
NT seq 2460 nt   +upstreamnt  +downstreamnt
atgtcaggaacctccaaggagagtctggggcatggggggctgccagggttgggcaaggcc
tgcttaacaaccatggacaaaaagctgaacatgctgaacgagaaggtggaccagctcctg
cacttccaagaagatgtcacagagaagttgcagagcatgtgccgagacatgggccacctg
gagcggggcctgcacaggctggaggcctcccgggcaccgggcccgggcggggctgacggg
gttccccacattgacacccaggctgggtggcccgaggtcctggagctggtgagggccatg
cagcaggatgtggcccagcacggtgccaggctggaggccctcttcaggatggtggctgcg
gtggacagggccatcgctttggtgggggccacgttccagaaatcaaaggtggcggatttc
ctcatgcaggggcgtgtgccctggaggagaggcagcccaggtgacagccctgaggagaat
aaagagcgagtggaagaagagggaggaaaaccaaagcatgtgctgagcaccagtggggtg
cagtctgatgccagggagcctggggaagagagccagaaggcggacgtgctggaggggaca
gtggagaggctgccccccatcagagcgtcagggctgggagctgaccccgcccaggcagtg
gtctcaccgggccagggagatggtgttcctggcccagcccaggcattccctggccacctg
cccctgcccacaaaggtggaagccaaggctcctgagacacccagcgagaacctcaggact
ggcctggaattggctccagcacccggcagggtcaatgtggtctccccgagcctggaggtt
gcaccaggtgcaggacaaggagcatcgtccagcaggcctgaccctgagcccttagaggaa
ggcacgaggctgactccagggcctggcccccagtgcccagggcctccagggctgccagcc
caggccagggcagcccacagtggtggagaaacacctccaaggatctccatccacatacaa
gagatggatactcctggggagatgctgatgacaggcaggggcagccttggacccaccctc
accacagaggctccagcagctgcccagccaggcaagcagggcccacctgggaccgggcgc
tgcctccaagcccctgggactgagcccggagaacagacccctgaaggagccagagagctc
tccccgctgcaggagagcagcagccccgggggagtgaaggcagaggaggagcaaagggct
ggggccgagcctggcacgagaccaagcttggccaggagcgacgacaatgaccatgaggtt
ggggccctgggcctgcagcagggcaaaagcccaggggcgggaaaccctgagcctgagcag
gactgtgcagccagggctccggtgagagccgaagcagtaaggaggacgcccccaggcgcc
gaggctggcagcgtggttctggatgacagtccggccccaccagctccttttgaacaccgg
gtagtgagcgtcaaggagacctccatctctgcgggttacgaggtgtgccagcacgaagtc
ttgggagggggccggtttggccaggtccacaggtgcacagagaagtccacaggcctccca
ctggctgccaagatcatcaaagtgaagagcgccaaggaccgggaggacgtgaagaacgag
atcaacatcatgaaccagctcagccacgtgaacctgatccagctctatgacgccttcgag
agcaagcacagctgcaccctcgtcatggagtacgtggacgggggtgagctcttcgaccgg
atcacagatgagaagtaccacctgactgagctggatgtggtcctgttcaccaggcagatc
tgtgagggtgtgcattacctgcaccagcactacatcctgcacctggacctcaagccggag
aacatattgtgcgtcaatcagacaggacatcaaattaagatcattgactttgggctggcc
agaaggtacaagcctcgagagaagctgaaggtgaacttcggcactcctgagttcctggcc
ccagaagtcgtcaattatgagtttgtctcattccccacagacatgtggagtgtgggagtc
atcacctacatgctactcagtggcttgtccccatttctaggggaaacagatgcagagacc
atgaatttcattgtaaactgtagctgggattttgatgctgacacctttgaagggctctcg
gaggaggccaaggacttcgtttcccggttgctggtcaaagagaagagctgcagaatgagt
gccacacagtgcctgaaacacgagtggctgaataatttgcctgccaaagcttcaagatcc
aaaactcgtctcaaatcccaactactgctgcagaaatacatagctcaaagaaaatggaag
aaacatttctatgtggtgactgctgccaacaggttaaggaaatttccaacttctccctaa

KEGG   Pan paniscus (bonobo): 100978891
Entry
100978891         CDS       T02283                                 

Gene name
MYLK2
Definition
(RefSeq) myosin light chain kinase 2
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04510  Focal adhesion
pps04611  Platelet activation
pps04810  Regulation of actin cytoskeleton
pps04921  Oxytocin signaling pathway
pps04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100978891 (MYLK2)
   04020 Calcium signaling pathway
    100978891 (MYLK2)
   04022 cGMP-PKG signaling pathway
    100978891 (MYLK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100978891 (MYLK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100978891 (MYLK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100978891 (MYLK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100978891 (MYLK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100978891 (MYLK2)
  09154 Digestive system
   04971 Gastric acid secretion
    100978891 (MYLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100978891 (MYLK2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100978891 (MYLK2)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100978891 (MYLK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH
Other DBs
NCBI-GeneID: 100978891
NCBI-ProteinID: XP_003814807
UniProt: A0A2R9C2Z8
Position
20
AA seq 596 aa
MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASE
KGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGS
QDPGKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVP
MTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGTEFQAVPSEKSEV
GQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC
TCMEKATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFME
YIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGH
LVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLS
PFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWL
NNLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggcgacagaaaatggagcagttgagctgggaattcagaacccatcaacagacaaggca
cctaaaggtcccacaggtgaaagacccctggctgcagggaaagaccctggccccccagac
ccaaagaaagctccggatccacccaccctgaagaaagatgccaaagcccctgcctcagag
aaaggggatggtaccctggcccaaccctcaactagcagccaaggccccaaaggagagggt
gacaggggcggggggcccgcggagggcagtgctgggcccccggcagccctgccccagcag
actgcgacgcccgagaccagcgtcaagaagcccaaggctgagcagggagcctcaggcagc
caggatcctggaaagcccagggtgggcaagaaggcagcagagggccaagcagcagccagg
aggggctcacctgcctttctgcatagccccagctgtcctgccatcatctccagttctgag
aagctgctggccaagaagcccccaagcgaggcatcagagctcacctttgaaggggtgccc
atgacccacagccccacggatcccaggccagccaaggcagaagaaggaaagaacatcctg
gcagagagccagaaggaagtgggagagaaaaccccaggccaggctggccaggctaagatg
caaggggacacctcgagggggaccgagttccaggctgttccctcagagaaatccgaggtg
gggcaggccctctgtctcacagccagggaggaggactgcttccagattttggatgattgc
ccgccacctccggcccccttccctcaccgcatggtggagctgaggaccgggaatgtcagc
agtgaattcagtatgaactccaaggaggcgctcggaggtggcaagtttggggcagtctgt
acctgcatggagaaagccacaggcctcaagctggcagccaaggtcatcaagaaacagact
cccaaagacaaggaaatggtgttgctggagattgaggtcatgaaccagctgaaccaccgc
aatctgatccagctgtatgcagccatcgagactccgcatgagatcgtcctgttcatggag
tacatcgagggcggagagctcttcgagaggattgtggatgaggactaccatctgaccgag
gtggacaccatggtgtttgtcaggcagatctgtgacgggatcctcttcatgcacaagatg
agggttttgcacctggacctcaagccagagaacatcctgtgtgtcaacaccaccgggcat
ttggtgaagatcattgactttggcctggcacggaggtataaccccaacgagaagctgaag
gtgaactttgggaccccagagttcctgtcacctgaggtggtgaattatgaccaaatctcc
gataagacagacatgtggagtatgggggtgatcacctacatgctgctgagcggcctctcc
cccttcctgggagatgatgacacagagaccctaaacaacgttctatctggcaactggtac
tttgatgaagagacctttgaggccgtatcagacgaggccaaagactttgtctccaacctt
atcgtcaaggaccagagggcccggatgaacgctgcccagtgtctcgcccatccctggctc
aacaacctggcagagaaagccaaacgctgtaaccgacgccttaagtcccagatcttgctt
aagaaatacctcatgaagaggcgctggaagaaaaacttcattgctgtcagcgctgccaac
cgcttcaagaagatcagcagctcgggggcactgatggctctgggggtctga

KEGG   Pan paniscus (bonobo): 100979422
Entry
100979422         CDS       T02283                                 

Gene name
MYLK
Definition
(RefSeq) myosin light chain kinase
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04510  Focal adhesion
pps04611  Platelet activation
pps04810  Regulation of actin cytoskeleton
pps04921  Oxytocin signaling pathway
pps04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100979422 (MYLK)
   04020 Calcium signaling pathway
    100979422 (MYLK)
   04022 cGMP-PKG signaling pathway
    100979422 (MYLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100979422 (MYLK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100979422 (MYLK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100979422 (MYLK)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100979422 (MYLK)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100979422 (MYLK)
  09154 Digestive system
   04971 Gastric acid secretion
    100979422 (MYLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100979422 (MYLK)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100979422 (MYLK)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100979422 (MYLK)
SSDB
Motif
Pfam: I-set Ig_3 Pkinase 23ISL ig Ig_2 V-set PK_Tyr_Ser-Thr C2-set_2 fn3 Ig_4 Ig_6 Kinase-like Kdo Invasin_D3 DUF5898 TCAD9 AvrM_N
Other DBs
NCBI-GeneID: 100979422
NCBI-ProteinID: XP_003825287
Position
3
AA seq 1858 aa
MAPGQLPRQTMGDVKLVSSSHISKTSLSVDPSRIDSMPLTEAPAFILPPRNLCIKEGATA
KFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATN
GSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRV
VVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGM
YTCLVVNGSGKASMSAELSIQGLDSANRSFGRETKATNSDVRKEVTSVISKESKLDSLEA
AAESKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAA
RVQPERRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAATRRIPMEGQRD
SAFPKFESKPQSQEVRENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSH
YLCLLKARTRDSGTYSCTASNAQGQVSCSWTLQVERLAVMEVAPSFSSVLKDCTVIEGQD
FVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALG
QVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSEPH
DGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDV
FTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGV
GADGGGSDRYGSLRPGWPARGQGWPQEEDGEDVRGVLKRCVETRQHTEEAIRQQEVEQLD
FRDLLGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSV
LAKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSN
AQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVN
CKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATITWTLNGK
TLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENT
KAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVE
LFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKL
GSRQAQVNLTVVGEPEPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANK
TWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVE
VSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFK
AYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFE
LTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAG
SLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSA
TWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRM
KKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAF
LEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQ
IDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE
NT seq 5577 nt   +upstreamnt  +downstreamnt
atggcacctggccagctgcccaggcagaccatgggggatgtgaagctggtttcctcgtca
cacatttccaaaacctccctcagtgtggatccctcaagaattgactccatgcccctgaca
gaggcccctgctttcattttgccccctcggaacctctgcatcaaagaaggagccaccgcc
aagttcgaagggcgggtccggggttacccagagccccaggtgacatggcacagaaacggg
caacccatcaccagcgggggccgcttcctgctggattgcggcatccgggggactttcagc
cttgtgattcatgctgtccatgaggaggacaggggaaagtatacctgtgaagccaccaat
ggcagtggtgctcgccaggtgacagtggagttgacagtagaaggaagttttgcgaagcag
cttggtcaacctgttgtttccaaaaccttaggggatagattttcagctccagcagtggag
acccgtcctagcatctggggggagtgcccaccaaagtttgctaccaagctgggccgagtt
gtggtcaaagaaggacagatgggacgattctcctgcaagatcactggccggccccaaccg
caggtcacctggctcaagggaaatgttccactgcagccgagtgcccgtgtgtctgtgtct
gagaagaacggcatgcaggttctggaaatccatggagtcaaccaagatgacgtgggaatg
tacacgtgcctggtggtgaacgggtcggggaaggcctcgatgtcagctgaactttccatc
caaggtttggacagtgccaataggtcatttgggagagaaacaaaggccaccaattcagat
gtcaggaaagaggtgaccagtgtaatctcaaaggagtcgaagctggacagtctggaggct
gcagccgaaagcaagaactgctccagcccccagagaggtggctccccaccctgggctgca
aacagccagcctcagcccccaagggagtccaagctggagtcatgcaaggactcgcccaga
acggccccgcagaccccggtccttcagaagacttccagctccatcaccctgcaggccgca
agagttcagccggaacgaagagcaccaggcctgggggtcctatcaccttctggagaagag
aggaagaggccagctcctccccgtccagccaccttccccaccaggcagcctggcctgggg
agccaagatgttgtgagcaaggctgctaccaggagaatccccatggagggccagagggat
tcagcattccccaaatttgagagcaagccccaaagccaggaggtcagggaaaatcaaact
gtcaagttcagatgtgaagtttccgggattccaaagcctgaagtggcctggttcctggaa
ggcacccccgtgaggagacaggaaggcagcattgaggtttatgaagatgctggctcccat
tacctctgcctgctgaaagcccggaccagggacagtgggacatacagctgcactgcttcc
aacgcccaaggccaggtgtcctgtagctggaccctccaagtggaaaggcttgccgttatg
gaggtggccccctccttctccagtgtcctgaaggactgcactgttattgagggccaggat
tttgtgctgcagtgctccgtacgggggaccccagtgccccggatcacttggctgctgaat
gggcagcccatccagtacgctcgctctacctgcgaggccggcgtggctgagctccacatc
caggatgccctgccggaggaccatggcacctacacctgcctggctgagaatgccttgggg
caggtgtcctgcagcgcctgggtcactgtccatgaaaagaagagtagcaggaaaagcgag
taccttctgcctgtggctcccagcaagcccactgcacccatcttcctgcagggcctctct
gatctcaaagtcatggatggaagccaggtcactatgactgtccaagtgtcagagcctcac
gatggcacccagccgtggttcatcagtaagcctcgctcagtgacagcctccctgggccag
agtgtcctcatctcctgcgccatagctggtgacccctttcctaccgtgcactggctcaga
gatggcaaagccctctgcaaagacactggccacttcgaggtgcttcagaatgaggacgtg
ttcaccctggttctaaagaaggtgcagccctggcatgccggccagtatgagatcctgctc
aagaaccgggttggcgaatgcagttgccaggtgtcactgatgctacagaacagctctgcc
agagcccttccacgggggagggagcctgccagctgcgaggacctctgtggtggaggagtt
ggtgctgatggtggtggtagtgaccgctatgggtccctgaggcctggctggccagcaaga
gggcagggttggccacaggaggaagacggcgaggacgtgcgaggggtgctgaagaggtgc
gtggagacgaggcagcacactgaggaggcgatccgccagcaggaggtggagcagctggac
ttccgagacctcctggggaagaaggtgagtacaaagaccctatcggaagacgacctgaag
gagatcccagccgagcagatggatttccgtgccaacctgcagcggcaagtgaagccaaag
actgtgtccgaggaagagaggaaggtgcacagcccccagcaggtcgattttcgctctgtc
ctggccaagaaggggacttccaagacccccgtgcctgagaaggtgccaccgccaaaacct
gccaccccggattttcgctcagtgctgggtggcaagaagaaattaccagcagagaatggc
agcagcagtgccgagaccctgaatgccaaggcagtggaaagttccaagcccctgagcaat
gcacagccttcagggcccttgaaacccgtgggcaacgccaagcctgctgagaccctgaag
ccaatgggcaacgccaagcctgccgagaccctgaagcccatgggcaatgccaagcctgac
gagaacctgaaatccgctagcaaagaagaactcaagaaagacgttaagaatgatgtgaac
tgcaagagaggccatgcagggaccacagataatgaaaagagatcagagagccaggggaca
gccccagccttcaagcagaagctgcaagatgttcatgtggcagagggcaagaagctgctg
ctccagtgccaggtgtcttctgaccccccagccaccatcacctggacgctgaatggaaag
accctcaagaccaccaagttcatcatcctctcccaggaaggctcactctgctccgtctcc
atcgagaaggcactgcctgaggacagaggcttatacaagtgtgtagccaagaatgacgct
ggccaggcggagtgctcctgccaagtcaccgtggatgatgctccagccagtgagaacacc
aaggccccagagatgaaatcccggaggcccaagagctctcttcctcccgtgctaggaact
gagagtgatgcgactgtgaaaaagaaacctgcccccaagacacctccgaaggcagcaatg
ccccctcagatcatccagttccctgaggaccagaaggtacgcgcaggagagtcagtggag
ctgtttggcaaagtgacaggcactcagcccatcacctgtacctggatgaagttccgaaag
cagatccaggaaagcgagcacatgaaggtggagaacagcgagaatggcagcaagctcacc
atcctggccgcgcgccaggagcactgcggctgctacacactgctggtggagaacaagctg
ggcagcaggcaggcccaggtcaacctcactgtcgtgggtgaacccgaacccccagctggc
acaccctgtgcctctgacattcggagctcctcactgaccctgtcctggtatggctcctca
tatgatgggggcagtgctgtacagtcctacagcatcgagatctgggactcagccaacaag
acgtggaaggaactagccacatgccgcagcacctctttcaacgtccaggacctgctgcct
gaccacgaatataagttccgcgtacgtgcaatcaacgtgtatggaaccagtgagccaagc
caggagtctgaactcacaacggtaggagagaaacctgaagagccgaaggatgaagtggag
gtgtcagacgatgatgagaaggagcccgaggttgattaccggacagtgacaatcaatact
gaacaaaaagtatctgacttctacgacattgaggagagattaggatctgggaaatttgga
caggtctttcgacttgtagaaaagaaaactcgaaaagtctgggcagggaagttcttcaag
gcatattcagcaaaagagaaagagaatatccggcaggagattagcatcatgaactgcctc
caccaccctaagctggtccagtgtgtggatgcctttgaagaaaaggccaacatcgtcatg
gtcctggagatcgtgtcaggaggggagctgtttgagcgcatcattgacgaggactttgag
ctgacggagcgtgagtgcatcaagtacatgcggcagatctcggagggggtggagtacatc
cacaagcagggcatcgtgcacctggacctcaagccggagaacatcatgtgtgtcaacaag
acgggcaccaggatcaagctcatcgactttggtctggccaggaggctggagaacgcgggg
tctctgaaggtcctctttggcaccccggagtttgtggctcctgaagtgatcaactatgag
cccatcggctacgccacagacatgtggagcatcggggtcatctgctacatcctagtcagt
ggcctttcccccttcatgggagacaacgataacgaaaccttggccaacgttacctcagcc
acctgggacttcgacgacgaggcattcgatgagatctccgacgatgccaaggatttcatc
agcaatctgctgaagaaagatatgaaaaaccgcctggactgcacacagtgccttcagcat
ccatggctaatgaaagataccaagaacatggaggccaagaaactctccaaggaccggatg
aagaagtacatggcaagaaggaaatggcagaaaacgggcaatgctgtgagagccattgga
agactgtcctctatggcaatgatctcagggctcagtggcaggaaatcctcaacagggtca
ccaaccagcccgctcaatgcagaaaaactagaatctgaagaagatgtgtcccaagctttc
cttgaggctgttgctgaggaaaagcctcatgtaaaaccctatttctctaagaccattcgc
gatttagaagttgtggagggaagtgctgctagatttgactgcaagattgaaggataccca
gaccccgaggttgtctggttcaaagatgaccagtcaatcagggagtcccgccacttccag
atagactacgatgaggacgggaactgctctttaattattagtgatgtttgcggggatgac
gatgccaagtacacctgcaaggctgtcaacagtcttggagaagccacctgcacagcagag
ctcattgtggaaacgatggaggaaggtgaaggggaaggggaagaggaagaagagtga

KEGG   Pan paniscus (bonobo): 100995666
Entry
100995666         CDS       T02283                                 

Gene name
MYLK4
Definition
(RefSeq) myosin light chain kinase family member 4
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04510  Focal adhesion
pps04611  Platelet activation
pps04810  Regulation of actin cytoskeleton
pps04921  Oxytocin signaling pathway
pps04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100995666 (MYLK4)
   04020 Calcium signaling pathway
    100995666 (MYLK4)
   04022 cGMP-PKG signaling pathway
    100995666 (MYLK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100995666 (MYLK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100995666 (MYLK4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100995666 (MYLK4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100995666 (MYLK4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100995666 (MYLK4)
  09154 Digestive system
   04971 Gastric acid secretion
    100995666 (MYLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100995666 (MYLK4)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100995666 (MYLK4)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100995666 (MYLK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo Kinase-like APH TCAD9
Other DBs
NCBI-GeneID: 100995666
NCBI-ProteinID: XP_014200687
Position
6
AA seq 378 aa
MSSQEKEALKSHNCVLIYKSETEGDENHTPESSVIGLTTKMLKVKRLEEFNTCYNSNQLE
KMAFFQCREEVEKVKCFLEENSGDQDSRSGHNEAKEVWSNADLTERMPVKSKRTSALAVD
IPAPPAPFDHRIVTAKQGAVNSFYTVSKTEILGGGRFGQVHKCEETATGLKLAAKIIKTR
GMKDKEEVKNEISVMNQLDHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDENYNLT
ELDTILFMKQICEGIRHMHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKL
KVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVIAYMLWRISASEALKHPWLSDHKLHSRLN
AQKKKKNRGSDAQDFVTK
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgagcagtcaagagaaagaagcactgaagagtcataattgtgtcctgatttataaatcg
gagacagagggagacgaaaaccacactccagaaagtagcgtaatcggactcactactaag
atgttaaaagtgaagaggctggaagaattcaacacgtgttataacagcaaccagctggag
aaaatggccttttttcagtgcagggaagaggtggagaaagtgaagtgttttctggaagaa
aattctggggaccaggattcaagatctggacataatgaggcgaaggaggtgtggtcaaac
gccgacctgacggaaaggatgcccgtcaaaagcaaaaggacatcagccctcgcagttgac
atcccggctcctccggccccatttgatcatcgtattgtgacagccaagcaaggagcggtc
aacagcttctatactgtgagcaagacagaaatcctaggaggagggcgtttcggccaggtt
cacaagtgtgaggagacggccacaggtctgaagctggcagccaaaatcatcaagaccaga
ggcatgaaggacaaggaggaggtgaagaacgagatcagcgtcatgaaccagctggatcac
gcaaacctcatccagctgtacgatgccttcgagtctaagaacgacattgtcctggtcatg
gagtatgtggatggtggggagctgtttgaccgcatcatcgatgagaactacaatttgaca
gagcttgataccatcctgttcatgaagcagatatgtgaggggataaggcacatgcatcag
atgtacattctccacttggacctgaagcctgagaatatcctgtgtgtgaatcgggatgct
aagcaaataaaaattattgattttggattggccagaagatacaaacccagagagaagctg
aaggtgaactttggaaccccagaatttctcgcccctgaagttgtgaactatgattttgtt
tcatttcccactgacatgtggagtgtgggggtcatcgcctatatgctttggcgaataagt
gcaagcgaagctctcaagcacccctggttgtcagaccacaagctccactccagactcaat
gcccagaagaagaagaagaatcgtggctctgatgcccaggactttgtgaccaaatag

DBGET integrated database retrieval system