KEGG   Pan paniscus (bonobo): 100974885
Entry
100974885         CDS       T02283                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04072  Phospholipase D signaling pathway
pps04144  Endocytosis
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04520  Adherens junction
pps04540  Gap junction
pps04630  JAK-STAT signaling pathway
pps04810  Regulation of actin cytoskeleton
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04921  Oxytocin signaling pathway
pps04926  Relaxin signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps05160  Hepatitis C
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05207  Chemical carcinogenesis - receptor activation
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100974885 (EGFR)
   04012 ErbB signaling pathway
    100974885 (EGFR)
   04014 Ras signaling pathway
    100974885 (EGFR)
   04015 Rap1 signaling pathway
    100974885 (EGFR)
   04630 JAK-STAT signaling pathway
    100974885 (EGFR)
   04066 HIF-1 signaling pathway
    100974885 (EGFR)
   04068 FoxO signaling pathway
    100974885 (EGFR)
   04020 Calcium signaling pathway
    100974885 (EGFR)
   04072 Phospholipase D signaling pathway
    100974885 (EGFR)
   04151 PI3K-Akt signaling pathway
    100974885 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100974885 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100974885 (EGFR)
   04520 Adherens junction
    100974885 (EGFR)
   04540 Gap junction
    100974885 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100974885 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100974885 (EGFR)
   04915 Estrogen signaling pathway
    100974885 (EGFR)
   04921 Oxytocin signaling pathway
    100974885 (EGFR)
   04926 Relaxin signaling pathway
    100974885 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100974885 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100974885 (EGFR)
   05206 MicroRNAs in cancer
    100974885 (EGFR)
   05205 Proteoglycans in cancer
    100974885 (EGFR)
   05207 Chemical carcinogenesis - receptor activation
    100974885 (EGFR)
   05230 Central carbon metabolism in cancer
    100974885 (EGFR)
   05231 Choline metabolism in cancer
    100974885 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100974885 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100974885 (EGFR)
   05212 Pancreatic cancer
    100974885 (EGFR)
   05225 Hepatocellular carcinoma
    100974885 (EGFR)
   05226 Gastric cancer
    100974885 (EGFR)
   05214 Glioma
    100974885 (EGFR)
   05218 Melanoma
    100974885 (EGFR)
   05219 Bladder cancer
    100974885 (EGFR)
   05215 Prostate cancer
    100974885 (EGFR)
   05213 Endometrial cancer
    100974885 (EGFR)
   05224 Breast cancer
    100974885 (EGFR)
   05223 Non-small cell lung cancer
    100974885 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100974885 (EGFR)
   05171 Coronavirus disease - COVID-19
    100974885 (EGFR)
   05163 Human cytomegalovirus infection
    100974885 (EGFR)
   05165 Human papillomavirus infection
    100974885 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100974885 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100974885 (EGFR)
   01522 Endocrine resistance
    100974885 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100974885 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100974885 (EGFR)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100974885 (EGFR)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100974885 (EGFR)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100974885 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100974885 (EGFR)
  Exosomal proteins of bladder cancer cells
   100974885 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT ABC1 Kdo
Other DBs
NCBI-GeneID: 100974885
NCBI-ProteinID: XP_008967087
UniProt: A0A2R9CMH6
Position
7
AA seq 1157 aa
MFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYY
ENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFL
SNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCH
NQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVK
KCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINA
TNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPEN
RTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYAN
TINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGR
ECVDKCNILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCIK
TCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGA
LLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH
VCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRL
VHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTH
QSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDA
DEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTMACIDRNGLQSCPIKEDSFLQRYSSDP
TGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPTPSRDPHYQDPHSTAV
GNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAE
NAEYLRVAPQSSEFIGA
NT seq 3474 nt   +upstreamnt  +downstreamnt
atgttcaataactgtgaggtggtccttgggaatttggaaattacctatgtgcagaggaat
tatgatctttccttcttaaagaccatccaggaggtggctggttatgtcctcattgccctc
aacacagtggagcggattcctttggaaaacctgcagatcatcagaggaaatatgtactat
gaaaattcctacgccttagcagtcttatctaactatgatgcaaataaaaccggactgaag
gagctgcccatgagaaatttacaggaaatcctgcatggcgccgtgcggttcagcaacaac
cctgccctgtgcaacgtggaaagcatccagtggcgggacatagtcagcagtgactttctc
agcaacatgtcaatggacttccagaaccacctgggcagctgccaaaagtgtgatccaagc
tgtcccaatgggagctgctggggtgcaggagaggagaactgccagaaactgaccaaaatc
atctgtgcccagcagtgctccgggcgctgccgcggcaagtcccccagtgactgctgccac
aaccagtgtgccgcaggctgcacgggcccccgggagagcgactgcctggtgtgccgcaaa
ttccgagatgaagccacgtgcaaggacacctgccccccactcatgctctacaaccccacc
acgtaccagatggatgtgaaccccgagggcaaatacagctttggtgccacctgcgtgaag
aagtgtccccgtaattatgtggtgacagatcacggctcgtgcgtccgagcctgtggggcc
gacagctatgagatggaggaagacggcgtccgcaagtgtaagaagtgcgaagggccttgc
cgcaaagtgtgtaacggaataggtattggtgaatttaaagacacactctccataaatgct
acgaatattaaacacttcaaaaactgcacctccatcagtggcgatctccacatcctgccg
gtggcatttaggggtgactccttcacacatactccgcctctggatccacaggaactggat
attctgaaaaccgtaaaggaaatcacagggtttttgctgattcaggcttggcctgaaaac
aggacggacctccatgcttttgagaacctagaaatcatacgcggcaggaccaagcaacat
ggtcagttttctcttgcggttgtcagcctgaacataacatccttgggattacgctccctc
aaggagataagtgatggagatgtgataatttcaggaaacaaaaatttgtgctatgcaaat
acaataaactggaaaaaactgtttgggacctccggtcagaaaacgaaaattataagcaac
agaggtgaaaacagctgcaaggccacaggccaggtctgccatgccttgtgctcccccgag
ggctgctggggcccggagcccagggactgcgtctcttgccggaatgtcagccgaggcagg
gaatgcgtggacaagtgcaacattctggagggcgagccaagggagtttgtggagaactct
gagtgcatacagtgccacccagagtgcctgcctcaggccatgaacatcacctgcacagga
cggggaccagacaactgtatccagtgtgcccactacattgacggcccccactgcatcaag
acctgcccggcaggagtcatgggagaaaacaacaccctggtctggaagtacgcagatgcc
ggccatgtgtgccacctgtgccatccaaactgcacctacggatgcactgggccaggtctt
gaaggctgtccaacgaatgggcctaagatcccttccatcgccactgggatggtgggggcc
ctcctcttgctgctggtggtggccctggggatcggcctcttcatgcgaaggcgccacatc
gttcggaagcgcacgctgcggaggctgctgcaggagagggagcttgtggagcctcttaca
cccagtggagaagctcccaaccaagctctcttgaggatcttgaaggaaactgaattcaaa
aagatcaaagtgctggggtccggtgcgttcggcacggtgtataagggactctggatccca
gaaggtgagaaagttaaaattcccgtcgctatcaaggaattaagagaagcaacgtctccg
aaagccaacaaggaaatcctcgatgaagcctacgtgatggccagcgtggacaacccccac
gtgtgccgcctgctgggcatctgcctcacctccaccgtgcagctcatcacgcagctcatg
cccttcggctgcctcctggactatgtccgggaacacaaagacaatattggctcccagtac
ctgctcaactggtgtgtgcagatcgcaaagggcatgaactacttggaggaccgtcgcttg
gtgcaccgcgacctggcagccaggaacgtactggtgaaaacaccgcagcatgtcaagatc
acagattttgggctggccaaactgctgggtgcagaagagaaagaatatcatgcagaagga
ggcaaagtgcctatcaagtggatggcattggaatcaattttacacagaatctatacccac
cagagtgatgtctggagctacggggtgaccgtttgggagttgatgacctttggatccaag
ccatatgacggaatccctgccagcgagatctcctccatcctggagaaaggagaacgcctc
cctcagccacccatatgtaccatcgatgtctacatgatcatggtcaagtgctggatgata
gacgcagatagtcgcccaaagttccgtgagttgatcatcgaattctccaaaatggcccga
gacccccagcgctaccttgtcattcagggggatgaaagaatgcatttgccaagccctaca
gattccaacttctaccgtgccctgatggatgaagaagacatggacgacgtggtggatgcc
gacgagtacctcatcccacagcagggcttcttcagcagcccctccacgtcacggactccc
ctcctgagctctctgagtgcaaccagcaacaattccactatggcttgcattgatagaaat
gggctgcaaagctgtcccatcaaggaagacagcttcttgcagcgatacagctcagacccc
acaggcgccttgactgaggacagcatagacgacaccttcctcccagtgcctgaatacata
aaccagtccgttcccaaaaggcccgctggctctgtgcagaatcctgtctatcacaatcag
cctctgaaccccacgcccagcagagacccacactaccaggacccccacagcactgcagtg
ggcaaccccgagtatctcaacactgtccagcccacctgtgtcaacagcacattcgacagc
cctgcccactgggcccagaaaggcagccaccaaattagcctggacaaccctgactaccag
caggacttctttcccaaggaagccaagccaaatggcatctttaagggctccacagctgaa
aatgcagaatacctaagggtagcgccacaaagcagtgaatttattggagcatga

DBGET integrated database retrieval system