KEGG   Pan paniscus (bonobo): 100974934
Entry
100974934         CDS       T02283                                 

Gene name
CASP3
Definition
(RefSeq) caspase 3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01524  Platinum drug resistance
pps04010  MAPK signaling pathway
pps04115  p53 signaling pathway
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04650  Natural killer cell mediated cytotoxicity
pps04657  IL-17 signaling pathway
pps04668  TNF signaling pathway
pps04726  Serotonergic synapse
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05014  Amyotrophic lateral sclerosis
pps05016  Huntington disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05222  Small cell lung cancer
pps05416  Viral myocarditis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100974934 (CASP3)
   04668 TNF signaling pathway
    100974934 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100974934 (CASP3)
   04215 Apoptosis - multiple species
    100974934 (CASP3)
   04115 p53 signaling pathway
    100974934 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100974934 (CASP3)
   04657 IL-17 signaling pathway
    100974934 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    100974934 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100974934 (CASP3)
   05206 MicroRNAs in cancer
    100974934 (CASP3)
   05205 Proteoglycans in cancer
    100974934 (CASP3)
   05203 Viral carcinogenesis
    100974934 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100974934 (CASP3)
   05222 Small cell lung cancer
    100974934 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100974934 (CASP3)
   05161 Hepatitis B
    100974934 (CASP3)
   05160 Hepatitis C
    100974934 (CASP3)
   05164 Influenza A
    100974934 (CASP3)
   05162 Measles
    100974934 (CASP3)
   05168 Herpes simplex virus 1 infection
    100974934 (CASP3)
   05163 Human cytomegalovirus infection
    100974934 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100974934 (CASP3)
   05169 Epstein-Barr virus infection
    100974934 (CASP3)
   05165 Human papillomavirus infection
    100974934 (CASP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100974934 (CASP3)
   05133 Pertussis
    100974934 (CASP3)
   05134 Legionellosis
    100974934 (CASP3)
   05152 Tuberculosis
    100974934 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100974934 (CASP3)
   05145 Toxoplasmosis
    100974934 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100974934 (CASP3)
   05012 Parkinson disease
    100974934 (CASP3)
   05014 Amyotrophic lateral sclerosis
    100974934 (CASP3)
   05016 Huntington disease
    100974934 (CASP3)
   05020 Prion disease
    100974934 (CASP3)
   05022 Pathways of neurodegeneration - multiple diseases
    100974934 (CASP3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100974934 (CASP3)
   05416 Viral myocarditis
    100974934 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100974934 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100974934 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100974934 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100974934 (CASP3)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     100974934 (CASP3)
Peptidases and inhibitors [BR:pps01002]
 Cysteine peptidases
  Family C14: caspase family
   100974934 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14 Erf4 SICA_beta
Other DBs
NCBI-GeneID: 100974934
NCBI-ProteinID: XP_003823509
Position
4
AA seq 292 aa
MAAIVRRLWKLIKVSMENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMG
LCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSK
EDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRG
TELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQ
YADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
NT seq 879 nt   +upstreamnt  +downstreamnt
atggctgctattgtgaggcggttgtggaagttaataaaggtatccatggagaacaccgaa
aactcagtggattcaaaatccattaaaaatttggaaccaaagatcatacatggaagcgaa
tcgatggactctggaatatccctggacaacagttataaaatggattatcctgagatgggt
ttatgtataatcattaataataagaattttcataaaagcactggaatgacatctcggtct
ggtacagatgtcgatgcagcaaacctcagggaaacattcagaaacttgaaatatgaagtc
aggaataaaaatgatcttacacgtgaagaaattgtggaattgatgcgtgatgtttctaaa
gaagatcacagcaaaaggagcagttttgtttgtgtgcttctgagccatggtgaagaagga
ataatttttggaacaaatggacctgttgacctgaaaaaaataacaaactttttcagaggg
gatcgttgtagaagtctaactggaaaacccaaacttttcattattcaggcctgccgtggt
acagaactggactgtggcattgagacagacagtggtgttgatgatgacatggcgtgtcat
aaaataccagtggaggccgacttcttgtatgcatactccacagcacctggttattattct
tggcgaaattcaaaggatggctcctggttcatccagtcgctttgtgccatgctgaaacag
tatgccgacaagcttgaatttatgcacattcttacccgggttaaccgaaaggtggcaaca
gaatttgagtccttttcctttgacgctacttttcatgcaaagaaacagattccatgtatt
gtttccatgctcacaaaagaactctatttttatcactaa

DBGET integrated database retrieval system