KEGG   Pan paniscus (bonobo): 100974952
Entry
100974952         CDS       T02283                                 

Gene name
CD38
Definition
(RefSeq) CD38 molecule
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00760  Nicotinate and nicotinamide metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04640  Hematopoietic cell lineage
pps04921  Oxytocin signaling pathway
pps04970  Salivary secretion
pps04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100974952 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100974952 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100974952 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100974952 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    100974952 (CD38)
   04972 Pancreatic secretion
    100974952 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100974952 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100974952 (CD38)
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     100974952 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     100974952 (CD38)
CD molecules [BR:pps04090]
 Proteins
  100974952 (CD38)
Glycosaminoglycan binding proteins [BR:pps00536]
 Hyaluronan
  Cell surface receptors
   100974952 (CD38)
SSDB
Motif
Pfam: Rib_hydrolayse
Other DBs
NCBI-GeneID: 100974952
NCBI-ProteinID: XP_003826847
UniProt: A0A2R9BE63
Position
4
AA seq 300 aa
MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFP
ETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN
KILLWSRIKDLAHQFTQVQQDMFTLEDTLLGYLADDLTWCGEFSTSEINYQSCPDWRKDC
SNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA
WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
NT seq 903 nt   +upstreamnt  +downstreamnt
atggccaactgcgagttcagcccggtgtccggggacaaaccctgctgccggctctctagg
agagcccaactctgtctcggcgtcagtatcctggtcctgatcctcgttgtggtgctcgcg
gtggtcgtcccgaggtggcgccagcagtggagcggtccgggcaccaccaagcgctttccc
gagaccgtcctggcgcgatgcgtcaagtacactgaaattcatcctgagatgagacatgta
gactgccaaagtgtatgggatgctttcaagggtgcatttatttcaaaacatccttgcaac
attactgaagaagactatcagccactaatgaagttgggaactcagaccgtaccttgcaac
aagattcttctttggagcagaataaaagatctggcccatcagttcacacaggtccagcag
gacatgttcaccctggaggacacgctgctaggctaccttgctgatgacctcacatggtgt
ggtgaattcagcacttccgaaataaactatcaatcttgcccagactggagaaaggactgc
agcaacaaccctgtttcggtattctggaaaacggtttcccgcaggtttgcagaagctgcc
tgtgatgtggtccatgtgatgctcaatggatcccgcagtaaaatctttgacaaaaacagc
acttttgggagtgtggaagtccataatttgcaaccagagaaggttcagacactagaggcc
tgggtgatacatggtggaagagaagattccagagacttatgccaggatcccaccataaaa
gagctggaatcgattataagcaaaaggaatattcaattttcctgcaagaatatctacaga
cctgacaagtttcttcagtgtgtgaaaaatcctgaggattcatcttgcacatctgagatc
tga

DBGET integrated database retrieval system